最新新编大学英语视听说第三册原文及答案
【精品】新编大学英语第三版视听说3听力答案(Unit1-Unit6)
Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问，应选C，请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √ 2×3×4√Jack 1 √ 4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11．FTFT2．South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1）import from abroad 2）sales manager 3）salary 4）sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√Ｃ×D√Ｅ×F√G×H√I√Ｊ2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√Ｂ×C√D√Ｅ×F√Ｇ×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1：Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2：1．1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√ 5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1）a.whales and dolphinsb.birdsc. tigers2）a. meat oilb.handbags shoesc.furd.ivory2.TFTT。
视听说第三册Unit4原文及练习答案(下)
Unit 4IV. Speaking OutMODEL 1 Can you give me some tips about how to get a good job?Susan: John, can you give me some tips about how to get a good job?John: Did you go to the job fairs and meet with companies?Susan: Yeah, I did. But they didn‟t seem to be interested in women. I thought about suing then for sexual discrimination.John: I‟m afraid it won‟t be much help. Have you looked at the want ads in the newspaper?Susan: I‟ve been checking the want ads every day for a week, but I can‟t find anything interesting that I‟m qualified for. And the few that I have seen arevery low-paying.John: Then try the Internet. You can use a search engine to find a job site related to your field.Susan: Good thinking! Thanks! I think I‟ll look for something in electronic engineering.John: Hey, I just saw a job opening at a company called E-Tech. It could be just the sort of thing you‟re looking for.Susan: Great, I‟ll try my luck there.John: Yeah, but if I remember, the deadline is this afternoon.Susan: This afternoon? Oh no! I‟d better get online quickly and see if I can submit my resume by E-mail.John:Wait, have you updated your resume?You‟d better include your work experience from the IT company last summer.Susan: Don‟t worry. It‟s all set. Thanks, mate.John:Any time, Sue.MODEL2 Do you have any tips for a successful interview? ScriptSusan: John, do you have any tips for a successful interview?John: Well, first of all, you need to dress professionally.Susan: Oh, what about during the interview?John: Ok, be sure to maintain good eye contact and answer all questions politely and directly. Don‟t look too shy, nor should you sound too aggressive.Susan: I‟m not sure what kind of questions they‟ll ask.John: They‟ll probably want to know a little about your work experience. Many companies don‟t want a completely green hand. They don‟t want to spend time and money on training.Susan:Fortunately, I gained some experience at an IT company during the last summer holiday.John: They may also want to know something about your character. You see, ability for teamwork is usually valued.Susan: What kind of questions should I ask them?John: You should ask them about the job requirements and about the company. Susan: Should I ask about salary and fringe benefits?John: Better not. Not unless they bring it up.Just use the first interview to sell yourself.Susan: You‟re right. If they are interested in hiring me, there will be plenty of chances to talk about money later.John: Right. And the more interested they are, the more they‟ll offer.MODEL3 Our best bet is to recruit from the competition. ScriptHelen: Our company is starting from scratch,so we don‟t have the expertise to compete.Bill: Then our best bet is to recruit from the competition.Helen: We need managers who know how to be strong, yet know how to give employees their freedom.Bill:That‟s essential, especially in the computer industry. Often computer experts like to work on their own.Helen: We also don‟t believe that a right management system will work wonders for our company.Bill: Um…that philosophy will help you attract many worthwhile people.Helen: I remember your friend David Miller is the CEO of a management recruitment agency. I hope he‟ll help us start a recruitment drive.Bill: Certainly. And it‟s a good time, too. A number of firms have been downsizing. Helen: Good. So lots of capable people out there are interested in bigger and batter things. But can David help us pin them down?Bill: Sure, Helen! That‟s why they call them headhunters.V. Let’s TalkScriptGood afternoon, everyone. The university‟s Career Office asked me to give a talk on the topic of how to prepare for job interviews. This is probably the most important aspect in securing a job. Here are some tips I believe to be useful.First, do some research are. Once you have this information, make a list of what skills or knowledge you have that would be valuable to them. You cannot sell yourself to them if you don‟t know what it is you are selling.The next thing to consider is your physical appearance. You have to dress right for job interviews. Don‟t wear anything too flashy; being neat and clean is more important than wearing the latest fashion. The aim is to look professional without overdoing it. Also, it is important that you feel comfortable. If you are not comfortable with a tie, it might be best not to wear one, unless the job requires you to dress this way. The last thing you want is to be worried about your appearance during the interview. It will only make you nervous, and you will quickly lose confidence.Mover over, you have to work out what you need to take with you: A copy of your CV, originals and copies of your qualification paper, copies of reference, samples of your work, if applicable, and anything else that they may want to see. Again, make sure everything is well organized and neatly presented. Don‟t take a pile of paperwork that you have to sift through for ten minutes to find something. That will give them the impression that you are disorganized. If you are well prepared, you‟re likely to have good luck.VI. Further Listening and SpeakingTask1: The Role Memory Plays in Our LifeScriptYour resume, or CV in British English, has one mission and one mission only: to get you a job interview. Your resume is usually the first impression an employer has of you. And as “you never get a second chance to make a first impression”, you…d better get it right firs time. Here‟re some suggestions that may be of use in preparing a resume. First, use a design that demands attention. Employers don‟t have time to read through each of your job descriptions to know if you have the skills they need. The design of your resume must do it for them. Your resume should be concise, well-organized and relevant. It should emphasized the most important and relevant points about your experience, skills and education.Second, put important information first. List important information at the beginning of your job descriptions. Put statements in your resume in order of importance and relevance to the job you want. A powerful statement with exact numbers influences every statement that follows.Third, target the job. You will have more success if you adjust your resume and cover letter for the specific skills another job. In other words, you need to “re-package”yourself. In that way, an employer will see immediately that you correspond to the job description. It is not dishonest to “re-package”yourself. You are simply pressing yourself and your skills in the best light for a particular employer. This will help you to get more interviews and allow you to apply for a wider range o jobs.1.Why does the speaker say the resume is important?2.According to the passage, why should you emphasize the most important pointabout yourself?3.Where does the speaker advise putting the important information in your jobdescription?4.How many resumes would the speaker advise you to write if you applied for threejobs?5. Which of the following makes a good title for the passage?Keys: 1.C 2.A 3.A 4.C 5.BTask 2: Two Essential Factors in an InterviewScriptWhen applying for a job, especially a job you really want. It‟s not usually to feel nervous and anxious. Sometimes it‟s this anxiety, not our qualifications, that keeps us from obtaining our dream job.So you must overcome your nervousness and build up confidence. This often involves two factors: one mental and the other physical. Mentally, it‟s important to prepare yourself for the interview without obsessing over it. Remember, it might be your dream job, but it won‟t be the end of the world if you don‟t get it. Tell yourself that the company would be lucky to get you; and if they choose someone else, it will be their loss. In essence, you need to build your self-confidence. Your ability to answer all questions without hesitation will certainly impress the interviewer.Now that you are mentally ready for any question that might be thrown your way, it‟s time to work on your physical presentation. No matter what position you are applying for, your physical appearance at the interview will be a big factor in the final determination.It‟s always a good idea to wear a suit; it doesn‟t have to be a designer suit, but something plain and conservative. Do not dress too informally. For example, don‟t wear a red fashionable jacket for your interview. Make sure, too, that it is clean and pressed. This may seem like common sense, but you‟d be surprised how careless some applicants are. While it‟s not necessary to visit the beauty salon before your interview, make sure that your nail are well-manicured, and your hair is styled carefully and neatly.Task3: An Interview That Upsets the BossScriptJohn was in a terrible accident at work and lost both of his ears. Since he was permanently disfigured, he settled with the company for a fairly large compensation and decided to invest the money in a small but growing telecom business. After weeks of negotiations, he bought the company. Then he realized that he knew nothing about running such a business and quickly set out to hire someone who could do that for him.So he set up three job interviewers. The first guy was great. He knew everything the company needed and was very interesting. At the end of the interview, John asked him, ”Do you notice anything different about me?”And the gentleman answered, “Why yes, I couldn‟t help notice you have no ears.” John got very upset and threw him out.The second interview was with a woman, and she was even better than the first guy. He asked her the same question, “Do you notice anything usually about me?” and the she replied, “Well, you have no ears.” Again John got furious and tossed her out.The third and the last interview was the best of all three. It was with a very young man who was fresh out of college. He was smart and handsome. And he seemed to be a better businessman than the firs two put together. John was anxious to employ him, but asked him the same question, “Do you notice anything different about me?”And to his surprise, the young man answered, “Yes, you wear contact lenses.”John was amazed, and said, “What an incredibly observant young man! How in the world did you know that?”The young man laughed and replied, “Well, it‟s pretty hard to wear glasses with no ears!”For Reference1.He lost both of his ears.2.Because he realized that he knew nothing about running the business after hebought it.3.Because the interviewee said he noticed that John had no ears, and John got upset.4.He said he noticed John wore contact lenses.5.He thought it was pretty difficult to wear glasses with no ears.。
视听说III 原文和答案 Unit6
VLS B3 Unit 6II. Basic Listening Practice1.ScriptM: Did you pick up the paper for me today? I really want to check the job vacancies.W: I know, it’s over there. There’s not much happen though. I had a look already. Maybe you should look on the Net instead.Q: What is the man looking for?2.ScriptM:You don’t have enough experience or qualifications for this role. What makes you believe you could handle the position?W: I’m a fast learner and enjoy learning on the job. My natural skills lie in this area, and I’m confident that I could handle the challenge. Given a chance, I would prove myself.Q: What is the woman saying?3. ScriptM: Could you help me with my resume? Jane said you’re good with these things, and I really need someone to edit it. It’s way too long.W: Sure, no problem, give I to me. A good resume should be no more than one page, you know. And it should list you experience in reverse chronological order. I can see we’ve got some work to do! Q: Which of the following is true according to the conversation?4. ScriptM: Could you tell me why you would like to work for our company?W: Well, it has a good reputation as an employer, and its products are quite popular in the marketplace.I would feel proud to work for a company like this and to contribute a great deal to its success.Q: Why does the woman apply for the job?5. ScriptW: Where do you see yourself in five years’ time?M: I aim to have been promoted to senior manager at the very least. I’m very ambitious and want to climb up the career ladder as fast as possible. I don’t want to feel miserable on the first rung in five years’ time, watching everybody above me.Q: What does the man want in fie years?Keys: 1.C 2.D 3. A 4.C 5.BIII. Listening InTask 1: Tips for job interviewsA: After listening to the career officer’s talk, I’ve now realizes the importance of getting prepared for an interview.B:Quite true. First of all, we should never be late for an interview. If you’re not punctual, they’ll suspect that you’ll be late for work in future.A: Before going to the interview, we had better pay attention to our dress. We must look professional without overdoing it. Careless clothes will lead them into thinking that you’re likely to do your job carelessly.B: During the interview, it is impor tant to look confident without being too pushy. It’s necessary to maintain eye contact. This shows your interest in the conversation, and helps to maintain the communication between you and the interviewer.A:Many employers attach importance to the education you’ve received. We need to highlight those courses especially valuable to the company.B: Book knowledge is not enough. We must show them we have practical experience in the field. Tell them about our internship, and emphasize the skills that are useful in the job we’re seeking.A: How clever you are! These days many students want to tell the prospective employer that they have a good command of English and have obtained a College English Test Band 4 Certificate.B: They’re also eager to tell interviewer about their computer skills with PowerPoint, office automation, and so on. Students from non-key universities especially need certificates to shoe they’ve acquired those skills before they can hope to compete against students from prestigious universities.A: Character is considered an important factor in contemporary society, where teamwork is a must.B: But too many students are saying more or less the same thing. If everybody says, “I’m warm-hearted and cooperative, get along well with my classmates, and have good team spirit,” the boss will soon get fed up.A: Perhaps we should let the work we’ve done shoe our character.B: Right on. Participation is important. If you can show them you’re an important official of the Student Union of the university or the department, or you’ve organized a singing competition and won an award, obviously you’re a good team player.Key:1. T 2. F 3. T 4. T 5. F 6. T 7. TTask 2 Are you ready for a phone interviewScript and keyNowadays, many employers use telephone interviews to screen candidates in order to narrow the pool of applicants who will be invited for in-person interviews. They are also used as a way to minimize the expenses involved in interviewing out-of-town candidates.While you're job-searching, it's important to be prepared for a phone interview on a moment's notice. You never know when a recruiter might call. So, you'd better take a look at the following phone interview tips.Before the interview, you should get well-prepared. For example, you can compile a list of your background and skills, your strengths and weaknesses, as well as a list of answers to typical phone interview questions You need to keep your resume on the top of your desk or tape it to the wall near the phone, so it's at your fingertips when you need to answer questions. Also, you should have a pen and paper handy for note taking.It's helpful to practice interviewing. You can rehearse answers to those typical questions you might be asked. Have a friend or family member conduct a mock interview and tape record it, so you can see how you sound over the phone. In this way, you'll be able to hear your "ums" and "uhs" and "OKs", and you can practice reducing them from your conversational speech.During the phone interview, try to smile. Smiling will project a positive image to the listener and will change the tone of your voice. Over the phone, you must speak slowly, clearly and politely. You should use the interviewer's title (Mr. or Ms. and their last name), and remember to only use a first name if they ask you to. It is essential not to interrupt the interviewer. On your part, you should try to give answers that are short and to the point.Finally, remember your goal is to set up a face-to-face interview. After you thank the interviewer, ask if it would be possible to meet in person.Questions and key1. Which of the following is NOT mentioned as a purpose of screening candidates on the phone?B) To test candidates' psychological stability when thcy speak on the phone.2. What can you infer from the speaker's recommendation of compiling a list of information aboutyourself.C) Without it, you may become disorganized while being interviewed3. What does the speaker say about your resume?C) Put it near the phone.4. According to the speaker, why should you conduct a simulated interview?A) To reduce unnecessary words in an interview.5. Which of the following is suggested when you address the interviewer on the phone?D) All of the above.Task3: A Guide to a Successful Job InterviewScript and keyYour resume, or CV in British English, has one mission and one mission only: to get you a job interview. Your resume is usually the first impression an employer has of you. And as “you never get a second chance to make a first impression”, you‘d better get it right firs time. Here’re some suggestions that may be of use in preparing a resume. First, use a design that demands attention. Employers don’t have time to read through each of your job descriptions to know if you have the skills they need. The design of your resume must do it for them. Your resume should be concise, well-organized and relevant. It should emphasized the most important and relevant points about your experience, skills and education.Second, put important information first. List important information at the beginning of your job descriptions. Put statements in your resume in order of importance and relevance to the job you want. A powerful statement with exact numbers influences every statement that follows.Third, target the job. You will have more success if you adjust your resume and cover letter for the specific skills another job. In other words, you need to “re-package” yourself. In that way, an employer will see immediately that you correspond to the job description. It is not dishonest to “re-package”yourself. You are simply pressing yourself and your skills in the best light for a particular employer. This will help you to get more interviews and allow you to apply for a wider range o jobs.1.Why does the speaker say the resume is important?2.Which of the following will NOT be regarded as a feature of good resume?3.Where should you put the important information in your job descriptions according to the passage?4.How many resumes would the speaker advise you to write if you applied for three jobs?5. What is the passage mainly about?Keys: 1.C 2.A 3.A 4.C 5.BIV. Speaking OutMODEL 1 Can you give me some tips about how to get a good job? Susan: John, can you give me some tips about how to get a good job?John: Did you go to the job fairs and meet with companies?Susan: Yeah, I did. But they didn’t seem to be interested in women.I thought about suing then for sexual discrimination.John: I’m afraid it won’t be much help. Have you looked at the want ads in the newspaper? Susan: I’ve been checking the want ads every day for a week, but I can’t find anything interesting that I’m qualified for. And the few that I have seen are very low-paying.John: Then try the Internet. You can use a search engine to find a job site related to your field. Susan: Good thinking! Thanks! I think I’ll look for something in electronic engineering.John: Hey, I just saw a job opening at a company called E-Tech. It could be just the sort of thing you’re looking for.Susan: Great, I’ll try my luck there.John: Yeah, but if I remember, the deadline is this afternoon.Susan: This afternoon? Oh no! I’d better get online quickly and see if I can submit my resume by E-mail.John:Wait, have you updated your resume? You’d better include your work experience from the IT company last summer.Susan: Don’t worry. It’s all set. Thanks, mate.John:Any time, Sue.MODEL2 Do you have any tips for a successful interview?ScriptSusan: John, do you have any tips for a successful interview?John: Well, first of all, you need to dress professionally.Susan: Oh, what about during the interview?John: Ok, be sure to maintain good eye contact and answer all questions politely and directly. Don’t look too shy, nor should you sound too aggressive.Susan: I’m not sure what kind of questions they’ll ask.John: They’ll probably want to know a little about your work experience. Many companies don’t wanta completely green hand. They don’t want to spend time and money on training.Susan: Fortunately, I gained some experience at an IT company during the last summer holiday. John: They may also want to know something about your character. You see, ability for teamwork is usually valued.Susan: What kind of questions should I ask them?John: You should ask them about the job requirements and about the company.Susan: Should I ask about salary and fringe benefits?John: Better not. Not unless they bring it up. Just use the first interview to sell yourself.Susan: You’re right. If they are interested in hiring me, there will be plenty of chances to talk about money later.John: Right. And the more interested they are, the more they’ll offer.MODEL3 Our best bet is to recruit from the competition.ScriptHelen: Our company is starting from scratch, so we don’t have the expertise to compete.Bill: Then our best bet is to recruit from the competition.Helen: We need managers who know how to be strong, yet know how to give employees their freedom.Bill:That’s essential, especially in the computer industry. Often computer experts like to work on their own.Helen: We also don’t believe that a right management system will work wonders for our company. Bill: Um…that philosophy will help you attract many worthwhile people.Helen: I remember your friend David Miller is the CEO of a management recruitment agency. I hope he’ll help us start a recruitment drive.Bill: Certainly. And it’s a good time, too. A number of firms have been downsizing.Helen: Good. So lots of capable people out there are interested in bigger and batter things. But can David help us pin them down?Bill: Sure, Helen! That’s why they call them headhunters.Now Y our TurnSAMPLE DIALOGA: Can you give me some advice on how to succeed in an interview?B: Well, first of all, you need to pay attention to your appearance. You have to dress appropriately.A: What do you mean by appropriately?B: It’s often best to wear a suit. Some bosses don’t like to see a candidate on a dirty T-shirt and jeans. A: I see. Careless clothes may be an indicator of careless attitude in work.B: Right on. Also, many employers are unwilling to hire a young man with his hair dyed red or yellow. A: Then, what about during the interview?B: You should speak politely but firmly. If you look too shy, they may suspect you are not capable of dealing with a challenging task.A: I’m not sure what kind of questions they’ll ask.B: They’ll probably want to know something about your work experience. Companies usually don’t want an entirely new hand. They don’t want to spend time and money on training.A: Fortunately, I gained some experience at a law of firm during the last summer holiday. I worked as an intern to provide free legal advice for those who need it.B: Oh. I see, this is what they called “legal assistance to the needy”. Also, a company may want to know something about your character. You see, team players are often valued above all others.A: What kind of questions should I ask them?B: You should ask them about the job requirements and about the company.A: I hear that many companies asked the candidates what salary they expect.B: That’s true. You have to inquire about the possible salary level for a green hand in advance. If the salary you expect is reasonable, this shows that you know the professions well and will have a good impression on the interviewer.A: Oh, I’ve learned so much from you. A thousand thanks.V. Let’s TalkScriptV oice-over:T-Mobile is a subsidiary of Deutsche Telecom, the giant German telephone company.T-Mobile is their global mobile phone operation. Nine hundred people work at thecompany's call centre in Greenock, which was set up only five years ago; 760 of them areemployed in handling customer calls and they are managed by 70 team managers and 10operations managers. In a large-scale operation like this, the role of recruitment and trainingis the responsibility of a dedicated on-site human resources department.Woman: We have a training team, headed up by two leading advisers and supported by a number of customer-facing advisers who've been moved into the role of training. The theory behind is,these are the people who are doing the job, are in the best place to train that job to otherpeople.[On-screen text: Helen Young, Human Resources Adviser]Helen: Our recruitment is divided into two main sections. We have a CSA recruitment: Customer Service Adviser, and we also have all the other recruitment. It's crucial to us that we get the right people for the job, absolutely crucial, and we do whatever possible to ensure that people have realistic expectations of the job before they, before they're made an offer.Helen: In the initial stages they'd be given a telephone interview which would last somewhere in the region of 15 minutes. Following that, they'd be invited to come on-site. They'd have a tour of the centre. They then get, if you like, an opportunity to try us on for size. They get to see the role, they get to see how it feels, feel the culture of the company and if they're still happy at that stage and want to apply, then they need to do so formally. They would then complete an application form and be brought on-site for a two-hour assessment. The assessment consists of a role-play, which looks at their customer service ability and a competency interview. We need people who have the ability to communicate well and deliver the customer service that we want to deliver. We have a full age range of employees coming from various different backgrounds: manufacturing, customer service straight through to school leavers.Key(1) 900 (2) customer calls (3) 70 (4) human resources (5) supported (6) customer-facing (7) place (8) two (9) right people (10) realistic VI. Further Listening and SpeakingTask 1: Tell me about yourself.ScriptM: Tell me a little about yourself.W: I’m from Guilin City.M: What brought you to the east coast?W: I came to Qingdao to attend college. I’m impressed by this city’s dynamic economy. I’ve come to love it so much that I’ve decided to stay and work here.M: What work experience do you?W: I worked as an intern for a small shipping company. And my primary responsibilities were to maintain the company’s ties with the existing customers and try to find new cargo sources.M: And what did that experience teach you?W: I learned that communication skills are extremely important. The knowledge I acquired from textbooks is indeed, but it is equally essential to be able to persuade a potential client t to trust you. M: How would your former employer describe you?W: He told me that my ability to find one customer after another was an asset to the company. He thanked me for my loyalty. He also appreciated my team as shown in my cooperation with my colleague.M: You seem very mature for your age. And I see from your resume that you are very goal-oriented. W: Thank you. I believe I’ve acquired many good qualities from my parents. They’re my role models.However, I know I still have a lot to learn.The woman went from Guilin City to the east coast city of Qingdao to attend college. She was impressed by the latter’s dynamic economy. Now shi is being interviewed for a job. She says she once worked as an intern for a small shipping company to maintain the company’s ties with the existing customers and try to find new cargo sources. There she learned the importance of communication skills. She has realized that book knowledge is indeed necessary, but it is equally essential to persuade potential clients to trust her. Her former employer said her ability to find customers was an asset to the company. He appreciated the loyalty and team spirit. The interviewer finds her mature for her age and very goal-oriented. And she believes that she has acquired many good qualities form her parents, but still has a lot to learn.Task 2: A Work Qualification TestScriptMurphy applies for an engineering position at an Irish firm based in Dublin. An American applied for the same job. Quite by coincidence, the two amplifications, and were asked to take the same test by the manager of the Human Resource Department. Upon completion of the test, both men missed only one of the questions. The manager went to Murphy and said, “Thank you for your interest, but we’ve decided to give the American the job.”Bewildered by the manager’s decision, Murphy asked, “Why would you be doing that? We both got nine questions correct. This being Ireland and me being Irish, I should get the job!”The manger answered calmly, “We have made our decisions based on the correct answers, but on the question you missed.”Unconvinced and somewhat indignant, Murphy question, “And just how would one incorrect answer be better than the other?”The manager’s maser took him by surprise, “Simple, on QuestionNo.5, the American put down ‘I don’t’ know’, and you put down ‘Neither do I’.”Key: 1. F 2. T 3. T 4. F 5. TTask3: A guide to a successful job interviewThere are times that you will be asked a hard question during a job interview. Don’t panic, they just want to see how you handle a difficult situation. Being prepared is always the best policy. Here are some samples of questions and some advice on how to handle them properly.Why should we choose you? To this question, you can ask yourself why you applied, what makes you suitable for this question, what the company can gain from hiring you, what you have to offer, how you would handle this jib, etc.Often they ask you to tell them about yourself. You can split your answer into two, the professional and the personal level. Both are important, and how you move from one to the other depends on what you have to say. You can give a brief summary of your life, professional and personal, with lessemphasis on the early past, and more emphasis on the present and the future.When asked “What are your weakness?”, don’t say, “I don’t have any.” Everyone has weakness, and it takes s omething positive like, “I haven’t had a lot of exposure on the on-site work, but I’m looking forward to being more involved in dealing with customers directly and learning their needs.”Another common question is: “What are your strengths?”You should customize your answer to meet the position requirement. Keep in mind the things they asked for in the advertisement. Tell them your strengths, but also show them how they how they would apply to this job. To show how your strengths were valuable, use the “Why, where, when, how” to demonstrate and prove your strengths.1.What is the passage mainly concerned with?2.What does the speaker NOT mention as an answer to the question, “Why should we choose you?”?3.What does the speaker say you should stress when introducing yourself?4.What does the speaker advice you NOT to say when asked, “What are your weaknesses?”5.What should you say when asked about your strong points?Key: 1C 2.C3. B 4.A 5.DViewing and SpeakingKey:1) selection 2) pressure 3) marketing 4) interview 5) business6) nervous 7) laugh 8) redundant 9) difficult 10) sacking。
新编大学英语视听说3文本及答案Unit9
Unit 9Part OneAlice: Listen! The sound of that music! It...it's fascinating! Where...where is it from?Xiao Hong: Oh, I...I don't know actually.Henry: Over there! Shall we go take a closer look?Alice & Xiao Hong: OK.Xiao Hong: Oh, it's a kind of Chinese folk instrument called pipa.Alice: Wow, what a beautiful musical instrument!Xiao Hong: Sure.Henry: What's more, it makes such a marvelous sound!Xiao Hong: Oh, I'm glad to hear you say that. Actually, our folk instruments are quite unique. You know, the sound is beautiful and, as you see, it looks good. But, still, unfortunately, they are getting less popular these days.Alice: Really? That's incredible. You know, our Scottish bagpipes, which are some of the oldest instruments in the world, are still quite popular.Xiao Hong: Well, I'm afraid it's not the case in our country. Y ou know, I'm not exaggerating. Nowadays the vast majority of young people prefer western music to Chinese folk music, and they think Chinese folk music and classical instruments are old-fashioned.Henry: What a pity! Many people listen to bagpipes and they are heard on all kinds of different occasions. I wonder why Chinese folk instruments, as old as those bagpipes, are so little appreciated today.Xiao Hong: Well, I think historic reasons may partly account for it. You know, in ancient times, most of the Chinese folk instruments were used to please and entertain the nobles. You know, they were too expensive for ordinary people to own and play unless the poor played them in the street to earn a living.Alice: I know that some Chinese emperors loved music and had a good taste in it.Xiao Hong: Oh, yes, like Tang Xuanzong, but his ministers were firmly opposed to it. They believed that the emperor's attention might be distracted from ruling the country if he spent too much time on music. And they seemed to think of music as something trifling and unimportant. Henry: But things are quite different in our country. Our people are extremely interested in music, and are very proud of our traditions. We view music as part of our lives.Alice: Y eah, and our government spends a lot of money on music education. In the year 1999——2000 for example, the Department of Education spent 1.5 billion dollars on teaching music 1999so that lots of children had the chance to learn to play musical instruments.Xiao Hong: I do wish that more people would appreciate the exquisite melody of our folk instruments and be proud of our traditions.Henry: What's the difference between western music and Chinese music?Xiao Hong: Well, young people think that western music is more exciting and passionate. The rhythm is stronger, which makes them feel more excited. Well, on the other hand, the Chinese music is harmonious, soft, gentle, mild and calm. It helps make people feel peaceful, comfortable and relaxed.Alice: Y es, there are differences between Chinese music and...and western music, but one isn't really better than the other.Xiao Hong: No, no, no. Absolutely not. When I listen to Chinese music, the beautiful melodyalways reminds me of the beauty of nature, hills, streams, small bridges and the singing of birds. You know, the melody is like the music of the nightingale, the music of running water and etc. But western music is more upbeat and exciting. I get full of energy and I want to dance and sing with it. I like rock music better than folk music actually.Henry: Rock and roll has a long history in western countries. There are plenty of bands playing different kinds of rock and roll music, like heavy metal and punk.Xiao Hong: And most of our Chinese musical instruments are made of wood, bamboo or something like that, so the music sounds natural while yours nowadays are mostly made of metal and they seem to be much more complex.Alice: Right. Take our flutes for example. They have more holes and buttons, so they rely on very precise notes to produce music.Xiao Hong: What's more, western singers are usually good at dancing while they sing, but our singers are usually only good at singing.Henry: I suppose because of cultural differences, Chinese, like their music, are usually more reserved.Xiao Hong: There are still some people who prefer Chinese folk music. The pop music nowadaysis increasingly dominated by western music.Alice: I guess people are immediately attracted to western music, but Chinese music has the mysterious power to attract you without you realizing it.Xiao Hong: Y eah, Chinese traditional culture has made a deep impact on Chinese music. Y ou know, the music emphasizes people's feelings and is very emotional.Alice: I've heard that the structure of western music is more logical than that of Chinese music.Xiao Hong: I find that the lyrics are different too. Chinese people tend to express their emotions indirectly while western people are more direct and individualistic. They make full use of music and instruments to express their personal feelings, such as excitement, disappointment, love, sorrow and etc.Henry: Western music has absorbed many musical elements from African music. It places great importance on rhythm, such as heavy metal music, rock music, hip hop and so on.Alice: Yes, and, of course, we have a number of well-known composers these days.Henry: Mm, nowadays it seems that rock and pop music dominate the musical world. In many pieces of music, one instrument can be used in order to produce a distinct sense of perception.Xiao Hong: I guess, eventually, because of globalization, the differences between western music and Chinese music may become less noticeable. You know, in the future, the music may have a lot more in common than we have realized now.Alice: Oh, as far as pop music is concerned, what you say is probably true, but even though musicis a universal language, folk music shouldn't be changed.Xiao Hong: That's right. Don't you think it would be a good idea to buy some Chinese folk music CDs to take home with you?Alice & Henry: That's a good idea! Let's go to the CD shop.Exercise 21.C2.C3.C 4,W 5,W 6.C 7.C 8.C 9.C 10,W 11.W 12.W 13.C 14.W 15.W 16.C 17.W 18.WExercise 31.perfer old-fashioned2.as old as3.account for4.own play earn to living5.very proud of6.1.5 billion had the chance7.hillls small bridges singing of birds8.full of energy9.holes buttons precise notes 10.indirectly individualistic 11.places great importance12.a universal languagePartTwo Listening I(Bill, Howard, and Lisa are talking about background music.)Part IBill: What are you working on now?Howard: I've just finished a piece of background music.Lisa: Background music? Oh, like the music they're playing here now. Howard: Yes. You hear it everywhere, in restaurants, airports, supermarkets, department stores... Bill: In banks, too. I noticed it while we were at the bank today.Lisa: Did you? I didn't.Howard: Y ou are not supposed to notice it. It's just there, in the background. It's supposed to influence your attitudes, and put you in the right mood.Lisa: I'm not sure I like that idea.Howard: Well, it seems to work. Companies pay millions of dollars every year for background music. It's supposed to give you a better feeling about yourself and the people around you. Factories use it a lot. It makes the workers happy, and they work better that way. In one factory, music increased production by 4.5 percent.Bill: I should think they'd get tired of hearing music all day.Howard: They don't though. One fellow in San Francisco told me, "If the music stops, somebody always runs to the telephone to complain."Lisa: Now that I think about it, I can't remember when there wasn't background music in restaurants and stores.Howard: That shows how young you are. Actually, it all started during World War II when some factories had their own orchestras to keep workers happy and calm. Now, of course, the music is piped in by a machine, and different kinds of music are played at different times during the day. They play faster music at 10 in the morning than at 8, for instance, because workers tend to be slower then.Part IIBill: What about restaurants? Do they play the same music for dinner and lunch?Howard: I don't know about that, but I do know that hamburger places play fast music. When they started playing faster music, they found that a customer spent only seventeen minutes eating. The time was 22 minutes before that.Lisa: So they have more people coming in and out to buy hamburgers.Howard: Exactly. And that's good for business. You can see why music has become so popular. In Los Angeles, for instance, 30 different companies are selling background music services. Lisa: I still think there's something about it that I don't quite like.Howard: I know what you mean, but lots of people wouldn't agree with you. The Xerox Corporation in Rochester, N. Y Corporation in Rochester, N. Y., spends more than $80,000 a year for background music. Prisons ., spends more than $80,000 a year for background music. Prisons use it, and farmers use it to keep their cattle calm. It's even supposed to have an effect on plants.Exercise 11.restaurants airports supermarkets 12,attitudes in the right mood the people around him happy work better 3.World War II happy calm a machine kinds of music different times faster slowerExercise 21.T2.F3.F4.T5.T6.F7.T8.FListening IIMore and more doctors are operating to music. They say it eases their minds.One doctor in Chicago says classical music is the only kind that does not interfere while he is operating. But in another Chicago operating room, the British rock group Pink Floyd can be heard. And in Washington, at least one doctor operates to the sound of the Beatles.Researchers from the State University of New Y ork at Buffalo did a study that seems to confirm that music helps reduce tension in doctors. They gave fifty male doctors difficult mathematical kinds of tests.The doctors did the test while listening to music they themselves had chosen. They did a similar test while listening to music that was chosen for them. They were tested a third time with no music at all. Each time, a machine measured their heart rate and blood pressure.The doctors worked most quickly and calmly when listening to the music they themselves had chosen. They did the worst with no music at all.What kinds of music did the doctors choose? Mostly classical. But some chose instrumental jazz pieces or Irish folk music.There probably is one piece of music that should never be played during an operation: Brahms' "Lullaby". You do not want your doctor to go to sleep while operating, do you? Exercise 11.eases their minds operations2.classical instrumental jazz folk music3.A reduce tension B. 50/fifty male doctors C. Mathematics D.1)quickly 2)calmly 3)chosen for them 4)No music 5)the worst E. sleepyExercise 21.T2.F3.T4.F5.FPart ThreePractice OneThe Beatles were probably the most important pop and rock group of all time. They were together for only eight years, but their influence has lasted much longer.The Beatles came from Liverpool, England. They started playing together in 1962, although Paul McCartney and John Lennon played together in another group. They started by playing rock'n' roll songs, but they quickly developed their own style. By 1963, they had become Britain's top rock group. A year later they toured the United States, where they attracted millions of fans.By the time the Beatles broke up in 1970, they had changed the nature of rock and pop music. They introduced new sounds and rhythms, and they experimented with different types of musical instruments. They recorded hundreds of songs and they sold millions and millions of records. They made many films and won many awards for their music.Today, the Beatles' songs are still very famous all over the world.Exercise 1B D A CExercise 21.their own style2.the nature3.sounds experimented4.songs records5.films awardsPractice Two(Dennis is interviewing Stephanie, a music teacher.)Dennis: Which do you think is the easiest instrument for people to learn to play?Stephanie: It's difficult to answer that question because learning to play an instrument is one thing, and learning to play it well is another. But I think the guitar is the easiest to learn. It's one of the easiest to carry, and that's important for a musician.Dennis: And the second?Stephanie: My second choice is probably the most popular instrument, and I think it's the most satisfying, too, because you can make more progress at the beginning. That's the piano.Dennis: So you think playing the piano's more difficult than playing the guitar.Stephanie: Yes, because, well, your left hand has to work as hard as your right and both hands have to make notes. With the guitar, you make the notes with the left hand, and the right just picksthe strings.Dennis: Is playing a woodwind or brass instrument very difficult? It looks quite easy.Stephanie: I think the clarinet and the trumpet are the easiest to learn. Finding the notes is quite easy and breathing isn't a serious problem. But I find all the wind instruments less satisfying for people to play, because you can't do much alone. You have to play with others.Dennis: And which do you think is the most difficult instrument to play?Stephanie: No doubt at all, the violin. And I think it's the most difficult because both hands have to work, but they have to do different jobs. I mean, the left hand makes the notes on the strings, andit's harder to find the notes than on the guitar because the strings are shorter. The right hand has to manage the bow, and bowing well is an art. Finally, the most difficult thing about it, I find, is holding the instrument under your chin. It's not a natural position to adopt.Exercise 11.(1)trumpet (2)piano (3)violin 2(2)piano (1)clarinetExercise 21.picks the strings2.as hard as3.makes the notes4.on the strings5.manages the bowExercise 31.learn2.carry3.popular4.satisfying5.progress6.easiest7.less satisfying8.most difficultPractice Three(Four people, Steve, Connie, Diane, and Martin, are giving their opinions about their favorite musicians before attending an international concert.)Steve: Oh, no doubt about it. My favorite's Bruce Springsteen. He's the best there is. I think he's more direct, he communicates better than the others. It's not that the others are bad, but he's better.In a way his kind of rock music's more old-fashioned than, er, Sting's, say, but for me it's moreexciting. And the messages in his songs are simpler. They're easier to understand than Sting's or Peter Gabriel's, so I can relate to them better.Connie: The singer I want to hear most is Peter Gabriel. He's not really one of my favorite singerssingers——I mean I don't think he's as exciting as Bruce Springsteen, for instance—but his latest songs, these African songs with African rhythms, well, they're more musical than pop songs usually are. And I think all the singers are sincere about the human rights movement, but he feels more deeply about it than the others.Diane: Oh, I think Sting and his band are the best. Sting's better now with his new band than during his time with the Police. He seems more natural and I think he enjoys playing more. And he's a much better songwriter now. The one I like most in the band is the sax-player, Branford Marsalis. He plays brilliantly, but the best thing about him is his sense of humor. He really makes me laugh!Martin: To tell you the truth, I'm looking forward most to hearing Youssou N'Dour. I like Peter Gabriel's African songs, but he's an Englishman, not an African, so it's not the same as the real thing. I mean, real African music is different from reggae and rock, because it's more rhythmic than reggae, but not as heavy as rock. The rhythms are very unusual, too, and more sophisticated than people think.Exercise 11.T 2,T 3,T 4.F 5.F 6.F 7.F 8.TExercise 2Musicians BruceSpringsteen Sting PeterGabrielBranfordMarsalisYoussouN’Dourbrilliant √ communicative √direct √exciting √musical √natural √Not so heavy √ humorous √rhythmic √ simpler √ sophisticated √ unusual √Practice FourIt has long been known that Cellist Yo-Yo Ma possesses astonishing musical talent. By age seven he had already played for Isaac Stern and Pablo Casals. Later he went to Juilliard and on to Harvard, where he studied international cultures. Soon he tasted stardom, giving concerts around the world.But he tells of a humbling experience while in Namibia, where he went to observe trance dances and musical rituals of the people. At the end of his stay he produced a cello and offered them a performance of his own. "They said, 'Stop. Don't play. We want to play for you, '" Ma remembers with a laugh. "I think I was too self-important to bring my cello. They didn't give adamn."His story is one of a star realizing that not everyone knows or cares who he is. "To be a good performer, you have to have a very strong ego," he says. "But to be a really good performer, you have to make sure that your ego is not the center. To play Beethoven, you have to figure out who he was, and how that's encoded in the music. And then you have to realize you are not Beethoven."Exercise 11.A2.B3.A4.C5.AExercise 21.T2.N3.T4.F5.TPart FourSection 1Some people called John Lennon the "thinking man's Beatle". He was serious and creative, and many young people of the 1960s and 1970s thought he spoke for them.Lennon was born on October 9,1940, in Liverpool, England. During his childhood he listened to the music of rock 'n' roll singers like Elvis Presley, Jerry Lee Lewis, and Little Richard. At 15, when he was in an art school, Lennon started his first band, the Quarrymen. The band included Paul McCartney, George Harrison, and Pete Best, a drummer.The Quarrymen later changed their name to the Silver Beatles and then the Beatles. Ringo Starr replaced Pete Best as drummer. Between 1958 and 1962 the group played in nightclubs in Liverpool and Hamburg, West Germany. Then the Beatles made a record called "I Wanna Hold Your Hand" and changed the history of rock 'n' roll.Many people think that Lennon was the most important singer and songwriter of the Beatles. In general, his songs are sensitive and intelligent, and they still influence today's popular musicians.On December 8, 1980, a confused young man shot John Lennon outside his apartment building in New York City. A few days later, thousands of people gathered in New York's Central Park to remember him. For them, and for many other people in the world, he was someone very special.1.T2.F3.F4.T5.F6.T7.T8.TSection IIRock began in the U.S.A. in the early 1950s. At that time, "rhythm and blues" music was very popular with black Americans. "R&B" was a mixture of black religious music and jazz. It had strong rhythms that you could dance to and simple, fast lyrics.Noticing the success of R&B music, white musicians started to copy the same style. By the mid 1950s, this new white R&B music, called "rock 'n' roll", had become very popular. Singers like Elvis Presley and Bill Haley attracted millions of teenage fans. Their music was fast and loud. Many older people thought that rock 'n' roll was very dangerous.Rock music has continued to change and develop. It has combined with music from different parts of the world. Today, there are hundreds of different types of rock music, and almost every country has its own form of rock. There are "heavy metal" which is extremely loud with hard rhythms, "reggae" from Jamaica that combines rock with jazz and Latin rhythms, "rap" that hasdeveloped on the streets of New York, "disco", a type of soft rock music for dancing, "Afro-rock" that combines rock with African rhythms, "Mex-rock", which combines rock with traditional Mexican melodies...and many, many more.1 2√ 3 4√ 5 6 7√ 8√ 9 10√ 11 12√Section IIIBig Big Worldby Emilia*I'm a big big girl in a big big worldIt's not a big big thing if you leave meBut I do do feel that I do do will miss you muchMiss you muchI can see the first leaf fallingIt's all yellow and niceIt's so very cold outsideLike the way I'm feeling inside(Repeat the part marked with "*".)Outside it's now rainingAnd tears are falling from my eyesWhy did it have to happenWhy did it all have to end(Repeat the part marked with "*".)I have your arms around meWarm like fireBut when I open my eyes, you're gone(Repeat the part marked with "*".)I'm a big big girl in a big big worldIt's not a big big thing if you leave meBut I do feel I will miss you muchMiss you much1.falling2.nice3.cold4.inside5.raining6.tears7.happen8.arms9.fire 10,gone。
新编大学英语视听说book3Unit4听力答案及文本
新编大学英语视听说book3Unit4听力答案及文本1Unit 4Part OneListening IFor many of you this will be your last year at university and now is the time for you to begin thinking seriously about your future careers. In order to give you as much help as possible, I have quoted a list of questions that you ought to ask yourself.First, "Have I got a clear knowledge of my abilities as well as my interests?" Be honest about your weaknesses as well as your strengths. Take a really good look at yourself and give real thought to the kind of person you are, and what kind of person you want to be.Second, "Do I know the kinds of occupations in which people like myself tend to find success and satisfaction?" Talk to people who have similar abilities and interests and who are already in the careers that interest you. You can gain some idea of what they consider to be important and challenging in those careers. Watch these people at work.Third, "Have I weighed carefully the immediate advantages against the long-term prospects offered by the jobs I am considering?" Will the occupation you select give you satisfaction in the years to come? Realize now the importance of education in all fields, technical and professional. Remember that chances of promotion are usually given to educated persons—other things being equal.Fourth, "Have I talked with my parents, my teachers and my headmaster?" Remember they have a lot of experience that you can benefit from. They can help you think about the jobs. Theycan stimulate you to give careful thought to what you really want to do, and offer useful suggestions about how you might take full advantage of your personal qualities and qualifications.Last, "How do I regard my job? Is it just a means of getting money to do the things that I want to do? Is the work important to my future happiness? Is it a combination of both?"The above questions and their answers should give you some better ideas about how you should start planning your career. Your life-long job cannot be approached in any kind of haphazard fashion. It must be considered carefully, examined from every angle, and talked over with those who know you and those who can help you in any way.Exercise 12、4、5、6、8Exercise 21. weaknesses2. similar abilities and interests / interest you/ important and challenging3. education/ promotion/ educated persons4. parents/ teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II(Here's a dialog between a woman whose job is to help people find jobs and a man looking for a job.)Woman: Look. Here's a job that might interest you.Man: What is it? Are you sure? The last job interview you sent me off to was a disaster.Woman: Well, look. It says they want a sales manager, and it looks like it's a big international company. That'd be good. Youmight get to travel.Man: What kind of company is it, though?Woman: Um, let's see. Yes, it's a textile company that seems to import from abroad. They say the salary is really good. They operate a system of paying you a basic salary and then offering you a sales commission on top of that. They say it is high. And oh, look! They give you a car to travel round in. That's not bad, is it?Man: Um, do they say anything about experience?Woman: Um, let's see. No, they want someone young with ambition and enthusiasm. Oh yes, they want graduates, so that's OK. You've been to university. Now what else? Let's see.Man: There must be some catch.Woman: No, the only thing is you have to travel, but then that's what the company car's for. Oh, and you have to be able to get on well with other people because it says you have to be good on a team.Man: Um, perhaps I'll have a closer look at that one.Exercise 11. D2. D3. A4. BExercise 21. import from abroad2. sales manager3. salary4. sales commission5. travel in6. experience7. university8. on a teamListening IIIInterviewer: Some people feel that their jobs are misunderstood by others. Is that very common?Sociologist: Oh, absolutely. Most jobs or professions have an image or stereotype attached to them, and some of these are not realistic. The serious point is that young people choose their careers based on these false images, and they may even avoid certain careers which have a negative image. This can cause problems for the economy.Interviewer: Is there evidence of this problem?Sociologist: Yes, there was a recent survey of children's attitudes to different professions.Interviewer: How was this done? Children don't know much about jobs and professions.Sociologist: True. What the investigators wanted to get was children's impressions and prejudices. They gave the children twelve pairs of statements, one of the pair positive, and the other negative. Children were asked to say which of the statements was "most true" for each profession.Interviewer: For example?Sociologist: Well, for example, "Such and such a person is likely to be boring or interesting company."Interviewer: I see. What professions did they ask about?Sociologist: The list is long, but it included lawyers, economists, accountants, sales representatives, scientists and engineers.Interviewer: And the results?Sociologist: Well, they are striking, especially for engineerswho came out much worse than one might expect. About 90 percent of the children thought that engineering was a "dirty job", of "low status", and the engineer was more likely to take orders than to give them. The only other person they thought more likely to lose his job was the sales representative. But, there were good points too. Engineering was seen to be "interesting, well-paid work".Interviewer: Hmm, not a rosy picture.Sociologist: No, but it got better when children were asked what they thought of the engineer as a person. Most of them chose positive comments, but most thought the engineer was likely to be badly dressed.Interviewer: What about other professions? What were the most popular?Sociologist: Oh, the lawyers by far. Next came accountants and scientists as well as economists. The engineers and sales representatives were the least popular.Interviewer: Sounds like a sign of the times.Sociologist: Yes, but I think the most serious implication was the children's apparent ignorance of the importance of the engineer's role in society.Exercise 11. choose their careers2. avoid certain careers3.different professions4. impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. F3. T4. F5. TListening IVMegan: Tim, if you could pick any occupation in the world, what do you think would be a cool one?Tim: Well, truth be told, i think it would be pretty awesome to be a commercial fisherman. Megan: Fisherman! Why would you want to be a fisherman?Tim: Believe it or not, i’m really fascinated by the ocean. I like spending time in the ocean and I think if you go out on those boats and get away from the land, you really get in touch with the sea.Megan: Is it dangerous, though?Tim: Oh, it can be dangerous, for sure. You can get caught in storms. It can be rough sometimes.Megan: Do you get paid a lot of money?Tim: Not so much, but that is not necessarily vital. You know, you can work with nature. You can catch healthful food, provide for yourself, and I think that’s really fulfilling. How about you , Megan? What do you think would be a cool job?Megan: I think I would like to be a writer.Tim: Why is t hat? Lots of writers don’t succeed in making much of a living.Megan:Well, being a movie star would be exciting too, or a rock star, but the fame is overwhelming—too many peoplealways want to talk to you or want your autograph. I think as a writer, you are doing something you love without all that pressure or the media coming after you, and you can sort of make your own workk schedule and do it where you like. You can write in the countryside in a cabin, or you can write in the city wherever you please. So, I think it is a very flexible, rewarding job.Tim: Yeah, you’ve got to have the aptitude for it, though. Do you think you have what it takes?Megan: No, not yet. I’m a terrible writer. But anyway, if I could have my pick of jobs, I’d like to be a writer.Exercise 11. C2. A3. C4. B5. DExercise 21. occupation, cool2. catch, provide, fulfilling3. media coming after you, making your own work schedule4. have my pick of jobsPart 4Further ListeningListening IThere are at least 100 million workers in the Unites States. Most of them are on the job 35 to 40 hours a week. Their typical day includes seven to eight hours of work. Usually, they have a 15-minute coffee break in the morning and in the afternoon. But work schedules vary from job to job.White-collar workers—office workers and manyprofessionals—usually have "nine to five" jobs. They begin at 9:00 a.m. and finish at 5:00 p.m. Monday through Friday. "Blue-collar" workers—mechanics, electricians, and laborers—often work from 8:00 a.m. to 4:00 p.m. In many factories, blue-collar workers come to work in eight-hour shifts. Typically, these shifts start at 8:00 a.m., 4:00 p.m., and midnight. Finally, sales people and managers in retail stores work on Monday and Thursday nights, when the stores are open. Many retail workers also work on Saturdays, and some work on Sundays.These are the normal schedules for most American workers. However, many businesses now use a new system called "flex-time scheduling". Under this system, the employees choose their own working hours. Some people work from 8:00 to 4:00 five days a week. Some work from 9:00 to 5:00. Other people work 10 or 12 hours a day four days a week. Employees and managers are both happy with the system. The employees like the freedom of choice, so they work hard. The managers, of course, like the hard-working employees.What, then, is a typical work schedule? It depends on the job—and on the workers.Exercise:1. 100 million2. 35 to 403. 7 to 84. office workers, many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday ,Thursday, Saturdays ,Sundays8.choose their own working hours, freedom of choice , happy withListening IIMan: How long have you worked for AM-ADMEL, Gill?Woman: Only for a year. It's May now, isn't it? Yes, I joined last August in fact.Man: August in 1996.Woman: Yes.Man: What did you do before that?Woman: I used to work for a travel agency in London.Man: It was interesting, wasn't it?Woman: Not really. It was just secretarial work, rather like this job. And it wasn't too well-paid. But I took a secretarial course when I left school and I couldn't think what else to do.Man: So you went straight from school into a secretarial course, didn't you?Woman: Well, not quite. I left school when I was 16, in 1989, I think it was. And then I went to work in a hotel in Austria for a year, to learn some German.Man: Austria? Why Austria?Woman: I don't know really. Well, we used to go there on holiday quite often when we were younger, and, well, I like Austria actually. Anyway then I went back and did the secretarial course. That was a year's course.Man: And then you got the job at the travel agency I suppose.Woman: Yeah, that's right. That was in 1991.Man: So you were there for five years!Woman: Yes, it's awful, isn't it? Actually, I'm thinking of giving it all up to become a nurse.Man: Really?Woman: Well, I worked in a hospital in Twickenham during my last year at school. Just cleaning and helping to make bedsand so on. It was part of our Practical Careers training.Man: And you liked it?Woman: Yes, it was interesting.Exercise1. A2. D3. C4. A5. DListening IIIMan: Well, now then, one thing I'd like to ask is, er, exactly why you applied for the job. I mean, just looking at your application form, you're actually over-qualified...Woman: Yes, I thought you might ask that. Um, the thing is, in my present job, although I'm actually in charge of a small team and I have a lot of responsibility, it's largely a desk job with a lot of paperwork...Man: And you're not too keen on being stuck in an office all day?Woman: To be honest, no, I'm not. I much prefer being out on site where I can supervise things, and deal with problems as they occur. And this job should give me the kind of contact with other engineers, architects, builders and so on.Man: Mmm. You'd certainly have to do quite a lot of traveling in the local area, you know, visiting different sites. You do realize, though, that the starting salary isn't as good as the salary in your present job?Woman: Yes, I realize that, but um, it does say in the job advertisement that the promotion prospects are very good.Man: That's true, and er, as this is a new project that we'reworking on, we think there'll be a very good chance of fairly quick promotion, depending on performance, that is...Woman: Yes, of course. Well, you see, I've got very little chance of promotion in my present job.I mean it's a very small company and there's nowhere really for me to go; that's why I'm looking around for somewhere else.Exercise1. C2. B3. D4. C5. AListening IVDavid: Hi! You're listening to Radio Southwest, the best in the southwest for music andup-to-the-minute news. Sue's here. Hello, Sue.Sue: Hello, David.David: And we've got the Jobspot for you today. So, if you're looking for a new job, this could be the spot for you. So, let's have a look, and see what we've got today.Sue: Well, the first one we've got is a cook. That's in a large, busy restaurant, so it's very useful to have had experience in cooking. Must be a high school graduate and the pay is $12 an hour. So that's not bad, is it? The hours are good too. That's Monday to Friday, 3:00 p.m. till 6:00 p.m.David: Great. Thanks, Sue. So that's a cook. Now, how do you fancy working out of doors? How do you fancy being a gardener? So as long as you're fit and strong, and at least 16 years old, that'll suit you. The pay is $8 an hour. And the hours, Tuesday to Saturday, 8:30 a.m. to 5:00 p.m., you have to work on Sundayonce a month, but on Monday the Garden Center's closed. Now, the sort of work you'd be doing is potting, watering, things like that. So, how about applying for that? Pay, $8 an hour. Sue, what else have you got?Sue: Right, Dave. Well, from outdoors to indoors. We've got a word processor operator job here. This job might suit a woman with school-age children, because the hours are only 15 hours a week. It's a small, friendly office, and they require a high school graduate with two years' experience operating a computer. Pay is $9 per hour. So, there you go. That's a nice job in an office. If you fancy any of those jobs, give us a ring here on Jobspot at Radio Southwest. And now back to the music.Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACE。
新编大学英语视听说教程第三册答案
Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-upExercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. Barbara Exercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourself1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving8. perfectly9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.d Exercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. d Practice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening II1. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. T1.south America; pet food; enough protein; develop2.much more; Asia; Africa3.position; natural resources; gone down; steady4.continue to rise5. getting richer and richer Practice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5. travel around in6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign languagePractice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy withSection II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. F1. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionPart TwoListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice one1. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice TwoExercise 1(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goalsExercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloud Part Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7. records8. agree9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。
新编大学英语视听说教程第三册标准答案
Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5.travel around in 6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice Two(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。
新编大学英语视听说教程3听力标准答案
Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly BExercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. T Exercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 T Practice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection II1. B2. B3. D4. B5. D6. A7. C 8. BSection III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. C Exercise 21. T2. F3. T4. T5. F6. F Listening III Exercise 11) stayed around 2) mouse catcher 3)rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7.F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. D Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7.F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction4) species5) oxygen 6) economic 7) conservation8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa￥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. F Exercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. B Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.T Exercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by10. sense11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. A Exercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debate Part TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.D Exercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory10. reduced11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. A Exercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages E Exercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathroomsExercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7)A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. D Section III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.T Part Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16.C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makesthe notes4. on the strings5. manages the bow Exercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. TExercise 2Bruce Springsteen: communicative, direct, exciting, simplerSting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorous Youssou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damaged Exercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. A Section II 1. C 2. B 3. D 4.A 5. B Section III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black11. white 12. shaking 13. wet 14. sweet15. delicious16. angel 17. grave 18. nights 19. days 20. taste。
新编大学英语3视听说教程答案
新编大学英语3视听说教程答案【篇一：新编大学英语视听说3纯答案版】t oneexe 2 d c b e aexe 3 t f t t t t f f t fpart twolistening iexe 1 bcda exe 2 ftftftlistening iiexe 1 bdadexe 2 30s, male, 1.90, long wavy, heavy built, light red sweater, beardlistening iiiexe 1 bcda exe 2 1, 4, 5, 7part threepractice oneexe 1 1) natural riches, 2) desert, 3) extinction, 4) species, 5) oxygen, 6) economic development, 7) conservation, 8) valuable income, 9) awareness, 10) slow downexe 2 tfftpractice twoexe 1 ffttexe 2 1) south america, pet food, enough protein, develop2) much more, asia, africa3) position, natural resources, gone down, steady4) continued to rise5) getting richer and richerpractice threeexe 11) the few seconds, 2) so thin, 3) beings from another planet, 4) focused on, 5) looked directly at, 6) all around, 7)until now, 8) despair grief and disgust, 9) started crying, 10) who was sleeping peacefully exe 2 1,2,3,5,8practice fourexe 1 bcacexe 2 love, together, mother, house, school, friends, father, month, beach, callpart foursection icomplained about, work, got out of, on the ground, shocked, cold-blooded killing, investigation, drug dealing, concern, against, strong views, using drugs, too early, respectable, accused ofsection ii cbabcsection iii 1) overcrowded cities, 2) poverty, disease, 3) the drift, 4) registration, 5) resentment, 6) attractive, 7) education services, 8) rural lifeunit 4part oneexe 2 1) computer programmer, 2) computer engineering, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical, 9) management, 10) 3600 exe 3 1,2,4,6,8,9,11,12part twolistening iexe 12,3,4,5,7exe 2 1)weaknesses, 2) similar abilities and interest, interest us, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combination listening iiexe 11) choose their careers, 2) avoid certain careers3) different professions, 4) children’s impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance exe 2 ttftftpart threepractice oneexe 1 ddabexe 2 sales manager, salary, sales commission, a car, travel round in, experience, university, on a team practice twoexe 1 bbaccexe 2 1) 65 words, 2)90 to 100 words, 3) with languages, translate letters, answer the phone, foreign visitors, second foreign languagepractice threeexe 1 cabdbexe 2 1) adf 2) bf 3) acepractice fourexe 1 1) sensitive extroverted, 2) kids, 3) doing a good job, 4) tolerance level, 5) patientexe 2tftftpart foursection i1. 100 million2. 35 to 403. 7 to 84. office workers, many professionals5. 8:00 to 4:006. eight-hour shifts7. monday, thursday, saturday, sundays8. choose their own working hours, freedom of choice, happy withsection ii daacdsection iii bccdaunit 5part oneexe 2 bacedfexe 31. over long distances2. look into it3. five times4. individual, group【篇二：新编大学英语视听说教程3 浙江大学(第二版)听力完整答案】t oneexercise 21. mike c2. sam e3. ted d4. simon a5. lillyb exercise 31. avoid power2. socialoutgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches9. traits improved10. get rid of characteristicspart twolistening iexercise 11. f2. f3. t4. f5. t6. texercise 21) outside world2) at home 3) wave hello 4) bow5) look straight in the eyes of6) openly7) look at my feet 8) shy and silentlistening iiexercise 11. sensitive/ caring independent / understanding2. good friend3. lifepeople4. learning being awareexercise 21. b2. c3. a4. d5. bpart threemore listeningpractice oneexercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blondmedium height6. unner-upexercise 21. t2. f3. t4. f5. f 6 tpractice twoexercise 11. four2. colleagues3. teacher4. susan5. barbara\exercise 21) paul d e j 2) susan b f3) maria c h4) peter a g ipractice three exercise 11. pedroenergetic2. mr. miller patient3. mr. smithhonest4. jake stubborn5. mrs. duke creativepractice fourexercise 11) f 2) t 3) f 4) f 5) texercise 21) flattering 2) critical3) popular4) reserved 5) english part fourtesting yourselfsection 11) upset2) sensible3) lecture 4) calm 5) strength6) landed 7) waving8) perfectly 9) wildly 10) beesection ii1. b2. b3. d4. b5. d6. a7. c8. bsection iii1) secretary 2) hard-working3) efficient 4) private5) army officer 6) help7) fond 8) independent9) shy10) fifteenunit 2part oneexercise 21. c2. b3. d4. b5.aexercise 31. in your handused to belong to2. practicing with3. talked to each other why not4. ask forfind a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacepart twolistening iexercise 11. b2. b3. a4. b5. cexercise 21. t2. f3. t4. t5. f6. tlistening iiexercise 11. a2. a3. b4. c5. cexercise 21. t2. f3. t4. t5. f6. flistening iiiexercise 11) stayed around 2) mouse catcher3) rats and mice4) got a paw 5) weak and thin6) make a wooden paw7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with12) eighteen mice part threemore listeningpractice oneexercise 11. b2. a3. a4. c5. dexercise 21. f2.t3. t4. f5.t 6 f 7. f 8.tpractice twoexercise 11. c d j2. a e g h3. b f iexercise 21. a2 .b3. d4.c 5. b6. dpractice three exercise 11. b2. d3. c4. d5. aexercise 21. f2. t3. f4. f5.f6. tpractice fourexercise 11. b2 . c3. b4. a5. d6. aexercise 21. f2. f3. t4. t5.fpart fourtesting yourselfsection 11. c2 . b3. c 4. b5. a6. csection ii1. t2. f3. f4. f5.t6. f7. t8. tsection iii1.18672. shipped ( if these cattle could be brought to abilene, they could be put on trains and shipped to cities in the north and east.)【篇三：新编大学英语视听说教程一册(最新第三版)一至六单元答案】t 1 1．1-5 ftftt2. 1-5 776-2235，65, 11，loud, quieter 1. 1-5 abbda2. 1-5 old, torn/ blue, by the hand, holiday, children 1.1-5 181st，very tired, take hold of; for her trouble, never/ again 1.1-5cdbdb2.. r: fulfills my every need./stay home, cook, clean, and watch the kids.e: open-minded/ something interesting to say.part 21. acdegij2. 1-8 in a mess, my turn, a hand, work on, expectations of,how about, too much, what we havepart 31. 1)-15) nicer, excited, promises, married, first, lasted, kids, enough, changes, loves, mad, care about, boy friend, get better, helppart 4 1. cefgkl2. 1-5 personality/ background, good sense of humor, terrible, different environments, looks 1. 1-5 ftftt2. 1-5 gone by, no sign, taken over, enough, limits 1. 1-5 tfftt2. 1-5 seventies, selfish, unnatural, husband, surrounded 1. 1-5 abdcd2. c: done his part of the houseworkh: high priority withw: responsibilityunit 2part 1 1. 1-5 tftft2. 1 he moved to newton.2 she wrote down the new address on it.3 it was thrown away. / the professor threw it away.4 the professor’s daughter. 1. 1-5 tffft2. 1)-12) far, away, lucky, forget, parked, over, route, miss, smile, drove, laughter, usual 1. 1-5 fttff2. abd/ fgi 1. 1 it’s about some ways of helping peop le improve their memory.2 she’s a communications trainer who teachers memory skills.3 record, retain and retrieve.4 using very intense visual images.2. 1 1)-4) records, figure out, organize, filing system,2 5)-9) elaborate, broken up, see, loudly, forgetpart 21. 1 4 6 72. 1-8 turn in, worry about, growing up, gone, on the right side, last night, turned out tobe, take/ off, lately, fixing for, made a mistake, turn onpart 31. 1 he is a 25-year-old italian, who has an exceptional memory.2 he is demonstrating the art of memory.3 how, where and why information is stored.4 when he was 11 years old.5 determination. / hard work and exercise.2. 1-7 randomly, repeats them, backwards, recall every detail/a year old, more forgetful families, heredity/ environment, the brain/ specific genes, a vacation/ a regular guy part 4 1. 1-5 ftftt 2. 1 the night before they left home.2 he questioned his wife about the things she had packed.3 on top of the piano. 1. 1-3 bca2.1 3 4 6 1. cbdaa2.1—c 2—a 3—b 1. bdf2. 1-6 her grandmother, a small area, a better sense, three or four, by smell, soap/ perfume uint3part11. w: french, the united states, mushrooms, umbrellam: german, spain, milk, bullfight ticket2. 1-5 t t t f f 1. 1-4 lecture, teller, give a lecture, never even smiled, exhausted2. 1-5 c a b a b 1. 1 4 62. a-e love, unity, purity, happiness, desire,6-8 yellow rose, yellow tulip, carnation 1. 1-5 f t f t t2. 1-4 husband, made a awful mistake, full of love, for wordspart 21. 1-9 f f t t f t t t t2. 1-8 lack communication skills, take the initiative, first thing, becoming boring, non-verbal language, facial expression, annoying, elsewhere, change for the betterpart 31. 1 eyes, face, head, shoulders and hands.2 she prefers barack’s.3 intensity.4 i’m a fighter!5 relaxed.2. 1)-12) examine, slight, intensity, contrast, relaxed, simplicity, confidence,negotiation, cool, information, resolution, passion.part 4 1. 1-8 c a b c a b a c 1 his left eye.2 a special kind of wood.3 his wooden eye.4 a less attractive girl.5 she had a particularly big nose.6 would you like to dance?7 excited.8 would i? would i?9 angry and hurt.10 wood eye. 1．1-8 make their space, spread your towels, coat/ small bag, library,one corner/ chair, across from/ briefcase, stiffened/ head, invaded2. 1-6 f f t t t f1. 1 intimate, personal, social, and public.2 culture.2. b a c dunit 4part1 1. 1-5 a c c a c2. 1-5 t f t f f 1.1-6 t f t t f t2. 1-7 this semester, need to know, different, the rules/ use, do our homework, reading about, questions/ answers 1. 2 3 1 4 5 62. 1-10 history, major, not, 2009, 2010, title, computer, out, shelf, reserve 1. 1-5 a c b b a2. g: competed, sang, laughed, children,ln: turn, next,lv: acting them out,lo: demonstrated, clapping our hands, posters, cards,ldv: stories, lay, shut, musicpart 21. 1-10 t f t f f f t t f t2. 1-10 what can i do, like sports, under construction, schoolwork, more about him, quit school, the tuition fee, in a rush, student loans, student centerpart31. 1-10 disaster, picture, totally, unbelievable, review, consider, particular,independently-minded, medicine, worthpart 4 1. 1-5 a b c a d2. 1-5 t t t f f1. 1-5 b c a a c1. 1-7 b c b c b a b1. 1-7 activity, information, writing, different, skills, position, involves,8 you cannot possibly discover all that you need to know at once.9 don’t be discouraged if your work is not p erfect at first.10 you should expect progress, not perfection, from yourselfunit 5part11. 42312. 1-10 cold, red, thick, warm, small, use, finished, middle, covered, rabbits 1. 1 it took place in laos.2 a buffalo.4 because the farmer was very intelligent.5 he said he was afraid the tiger might kill his buffalo when he was gone.6 he took his plow and hit the tiger.2 1-5 ftftf 1. 125792. 1 in the early hours yesterday.2 sleeping.3 in the games room.4 a lit cigarette end.5 because smoking is forbidden in the games room. 1. 1-5 badcb2. 1-5 living species, international/ reached, less demand/used to, organizations, atlantic/ pacificpart 21. acdfh2. 1-8 for generations/ well-known, came across, a pair of, black/ small, happen to, in the audience/ call on, became aware, further study/ types ofpart 31. 1-10 dictionaries, garden, forest, signals, 135, energy, move, across, logging, remaining2. 1)-10) tough, devised, rubs, fatten, hibernate, flexible, grasp, monkey, cigarpart 4 1. 1 he was a waiter.2 on a beach.3 for a short time.4 a dog.5 a sea lion.2. 1-5 up/ down, struggling, jumped through, came by, puzzled.1. 1-6 fttftf2. 1 a monkey, an ox and an elephant.2 because they are frightened.3 he takes hold of the lion, knocks it against the tree and stamps on the lion.4 in order to show he is the most powerful.5 the lion still does not understand why the elephant did that.。
视听说3完整版详细答案
视听说3完整版详细答案第一单元12/19 take a break why not some other time party available listen without talk to you about researching background work on hoping for break may be it By the way1A/5 she doesn’t work…… her sch…… she has…… she didnot…… she often1B/5 kind of it’s about right I did past three years paid of earned break the case in comparison to depends on a lot harder in general my roommate way too for myself a balance 2A/5 confident relaxed tense in a bad mood2B/5 1)How about 2)too 3)Why don’t 4)enough 5)Let’s 6)to walk3/5 1)am taking 2)work 3)have 4)am writing5/5 sorry I don’t I’m sorry That’d be ——第二单元3/19 money Goss They this on nick8/19 couldn’t has lost won’t-10/19 Tali Make HeNew story she can’t believe11/19 Nick too Talia doesn’t might not be12/19 get expert run broadcast competition In fact Speaking ought to give away Good thinking handle care audio expert fast on it You do hard to believe wake up smell the coffee crazy famous taking a bribe smart I hope get in the way work on 1A/5 alittle There thought would1B/5 heard about was caught they say what to think stuff you’d like to really convinced actually natural athlete in the season any opinion about disqualify for the sake of shame to in trouble with start rumors 2楼2A/5 连线arise对come up what对what that’s对that2B/5 trus croo bogus authentic3/5 Have have ever ought lately You’d better5/5 Idon’t wow They say Ap hey you You’re第三单元3/19 Nick career star8/19 More not the nike10/19 1\The audio 2\Don’t be 3\最长的 4\to go and talk11/19 hasn’t finish he it nay trick her12/19 Bad news audio expert check urgent be sure absolutely sure have an idea may remember confide in reporter researcher chance lose one more day only one more day won’t be sorry story get tell me everything deserve a break storycharming charm out of1A/5 They didn’t she didn’t she needed pop corn It’s a story1B/5 1)was thinking 2)That would be ok 3)this new mall 4)having a sale 5)kind of 6)a whole lot less 7)just really 8)endup using little 9)Well 10)little girl 11)the whale 12)sounded really good 13)a lot 14)a lot less 15)you know what 16) treat you to2A/5 1)figure it out 2)investigate 3) result 4)make sense 5)ruined2B/5 urg对very to put对risk Sem对one of charm对to persuade3A/5 Talia对is able to she tell对be able to Tony对is not able Talia对is able 3B/5 yours mine5/5 I have an well,Idon’t If you Do you What do it’s worth Let’s go第四单元2/1 9 the asked her :so: he rent her a little N ick8/19 diffcult amusing dis English gland10/19 They could Did He think all To win3楼11/19 doesn’t he can he wants angry12/19 isten your side of the story Nope all alike judgeme trust only goal helping win deal with mess chargesserious threw a game gambling debts gave access to stop from Did you or didn’t you throw the game get show viewers Take your pick innocent1A/5Those Recently Time doesn’t He works He looks really 1B/5 ran into my gosh doing fantastic the same old howexciting perfect for or something like thata boring job gets to telemarketing telephone company2A/5 allow plan jour a part2B/5 Take a pick /T ake it easy/Take your time /Take a look3A/5 aa the a3B/5 aren’t /will you/does she/could he/hasn’t he/doesn’t she/didn’t I/wasn’t he5/5 I think I know you How have you been No,I’m sorry I’m afraid you’ve got It was great Here’s my card 单元测试1/3How did对He no longer when对when2/3 Nick对Which story Nick对the same3/3 The announce ……plays The announce talks about poetry……identifics1/3 in a bad mood /exhausted2/3 trustworthy/dishonest3/3 disgraceful action relax not guilty be……sense of planto don’t hurry1/3 are am Let’s go too much Why don’t I4楼2/3 received am going to ever should ’d better3/3 aren’t you an was the have seen good my am ableto dfferent haven’t2/5 serious talk busy3/5 different same different5/5 rising risingSPEAKING1/3I’m sorry it sounds I just don’t that would be That sound really good 3/3If you Iwill spend That’s Ijust Let’s 第五单元3/19 It’s im He was Shy8/19 very she plays he anything she wants Nick to know unbelievable 10/19 He’s not He Nick He’s getting11/19 I’would Talia shocked annoyed12/19sure sounds like stupid a minute deliberately from college works for recognize teammate bothexcuse us media you’ve got that right get it worry you getting some pressure sit out badlyfrankly win without you1A/5 call Her she couldn’t 100 A little1B/5 the whole story on the phone this rebate A hundred dollars supposed to of the camera nice aboutit serial number is gone Oh man 8002A/5become excit succ…… like begin2B/5 1)do you feel 2)do you think 3)are loving 4)such 5)so 6)believe2009-11-21 10:125楼3/5 so /such a /so /such /so /such a5/5 1)can I ask you to take a2)I have to take care of3)I’m tied uo at the moment4)Would you mind if5)Can you please check6)OK,no problem7)please fill this form第六单元3/19 She was No the result Talia8/19 1\Nick put50000 into hisbank account 2\she believes 3\he owes 4\making money 5\people 6\Ibel that 7\can’t 9/16 keep investigating have no choice going with beat us to it You’ve got to admit missing something asthey seem in this case too trusting skeptical all right working on fair let my emotions color myjudgment let me down won’t be sorry10/19 speptical He believes should work The bank11/19 they have to some want Dony1A/5 are allow Wise stop ID Dany1B/5 says at bars to have their parents thirteen years old get drunk you know drinking irresponsiblytheir kids baby-sitter bar owners this is happening crazy2A/5 Take对we have we don’t 对we decide For对For one we never对we are 2B/5 1)deposited 2)bank account 3)As a matter of fact 4)Take it from me 5)For one thing 6)except for 7)go with 8)beat us to it 9)let us down6楼3A/5 going/talking/eating/yourselves/myself/had known/would have brought/crying over /enjoying3B/5 1)may 2)may not 3)Is he 4)will 5)might not 6)may 7)aregoing to 8)might5/5 Do you think might perhaps It’s didn’t Is it possible that Nick didn’t take the money might第七单元3/19He explained 最长的 annoyed8/19 It’s brand He agreed Because+最长的By cheatingg Because he wants to amuse Talia Because angry she was angry Nick had not told here the truth10/19 He wasn’t going to tell A business woman TO visit To wear11/19 He was curius He will wear it would She want to ……truth12/19 here it comes juice bar Aren’t you Do I know you Not yet interesting proposition Keep goingLet’s say deal endorse athletic That’s it business card on second thought pay visit1A/5 They party+最长的 Thefirst job in it she wanted shemight Thefirst could go to earlier1B/5 great opportunity audition for such a wonderful show the same night other plays coming along so perfect so great about be invited go for it2A/5 They paid me so that Ichanged I want to know The shoes will becone Ok It doesn’t come and experience 2B/5 confirmed lines cone out basically endorsed3A/5 1)was taking 2)called 3)checked 4)was playing 5)quicker 6)more concentrated3B/5 would rather prefer to would prefer to2009-11-21 10:127楼5/5 soundslike fun or really? oh,really? Isee How awful How did it go Did you have a good?第八单元3/19she was trying Talia there was8/19 he meant to make meet jack hci had never jackie has neverworked Talia might G ower Buil ding Frustra show forten years10/19 Because she thought Nick had lied to her Neither she was very she used the recoptionst’s11/19 he enjoy finding show her anger she thinks confsed 12/19 dead for a moment angry yell at Maybe Probably guest dial in big trouble have trouble with used to memory to makematters worse ridiculous took lunch voice mail available odd telling thetruth lying see a good story1A/5 she asked for Try to she could meeting 4321B/5 looking for I mean quite a while at the desk Whatever Kind of hard for her name impossible totally screwed up pretty clear meet me lobby 4 o’clock good idea try where she is why don’t you how that goes2A/5 please wait sorry+短的 If you+长的Nick ……punished Tia+长的 The right now2B/5 odd Anyway In that case yell at ridiculous3A/5 where I can When the how much it what kind of used to3B/5 someone / used to /didn’t use to /something /anything /单元测试2LISTENING1/3Talia tells Nick that she believes him: {1.Nick meets Jackie baker8楼 2.Nick explains the deal he made to Talia.3.Talia decided to do see Jackie.2/3 1.The receptionist gives the office location.2.The receptionist gives the directions to the office.3.The receptionist asks for a signature3/3He had a health accepting He accepesVOCABULARY1/4get along get going2/4criticizing pressure3/4mutter feelforsomeone. fellfunn whisper4/4 skeptical asking tostep acknowledged down madeup approachable Let them off transfGRAMMER*/2 (Amy:Hi,Ronnie) 22111即 better were having more intelligent was listening would rather*/2 (Dear Mom) 12122即used to be somebody who that person is anybody where she lives PRONUNCIATION1/4cann’t can used2/4he /E/ her4/4 she up at 长的1/4 sorry to how was it?3/4 I really double it It’spossdidn’t I’m tired up oh,really? Ihave to take care of Did he have4/4 oh,really? How was That’s great第九单元3/19 5点 looking for There8/19 Because he needed the recept he was still Because hewondeved He wasn’t very He over To find 6点9楼10/19 Because he was trying Tell the she has blue he just 11/19 I’m confused help she never12/19 anything else someone else either In fact cheer up as bad as describe business suit excutive at all1A/5 she can bring cook for Go to Aby’s Emily’s1B/5 favor wondering bring two of my friends definitely supposed to messed up have a great time decorations last minutecooking things great to serve 6:30 three of you2A/5 the news+短的 Are you interest Hey, can may you +长的 I hend by she +短的2B/5business overheard follow describ cheer up3A/5 1)rushed 2)was checking 3)was playing went3B/5may as honest as as positive as can could as disgusting as5/5 sorry,but No,pr…… sure can I leave ma y be I can is it ok Do you第十单元3/1 9 The woman The inter……did not answer An……Dear8/19 he got into he made an he could not Things wer badly hewanted the woman the soccer the intertiew10/19 Dean’s They wear both she felt sorry she took10楼11/19 he wespec ts she has sarc…… sorry12/19around lately ran into admired ruining his career prettysure different changing the color wannabe tried outExcept for took lunch performance beginning to unfoldOn the house in his favor soccer professionally1A/5 do a survey noise is a the univer+长的 housing therre should1B/5 on behalf of a couple of minutes greatly appreciated more time building classrooms dorm roomsobviously point better quality more people at least pretty nice spacious rental houses stay in mixedfeelings involved in helps them out definitely issue2A/5will be get up stop to his unexp be made2B/5 uspended preformance catch up on on the house trying out3A/5 on with/out /up3B/5 losing /saying/ to need/ to wait3C/5 until/when/have5/5 Actually T o tell you what do you I’m not really 同上 If you ask Frankly第十一单元3/19 she think To tell How good8/19 he understand she joked……reporter upset she knowNick Nick she talks……party10/19 It’s nicer he’s going……happened no kick+长的11楼11/19she is angry she doesn’t Dean sorry,Nick12/19 won’t be sorry admit lied There you are are got reservations just around the corner doing business so much pleasant talkoverover lunch sign basically says endorse the shoes tricked out of the way next in line star player amazing team office make sure1A/5 Sunday write Next w…… 4:30 M……1B/5 are responsible for Africa visual aid in the outline easy look that up really quick have it all done due Wednesday needto meet I’m supposed to do compile get our project done off the Internet helpful use bring those in tomorrow2A/5They+短的 jose+短的 jack+长的 we+短的jane’s+短的2B/5 persuasive tricked persuade raise broke over out of this word3/5 went to see In orderto don’t have to help can’t to talk 5/5 I’ve got to is there anything Nothing I really need to Do you That’ll be第12单元3/19 To keep By working Nicknever had8/19 Nick is more To tell him he is That having money problem they have been hard to the so长的10/19 Surprisees长的He want’s ......truth To prove He didn’t (i)2009-11-21 10:1212楼11/19he is N ick’s tell Nick 长的 almost uncertain12/19buddy Tough rap really happened scheme talented plotting for dreamed up fake planning impressedtalking crazy expect figure out made up craziest stories pulledoff typical so sure of popular prove———-1A/5 she could she turned长的 A map of Africa Tuesday3小时 Teacher1B/5 the habitat of the animalsblue folder rest of the projectmap definitely different spotturned it in reliable sourcecoming to me instead of positively check with2/5 handed it in figured let you turn it3A/5 how long for since has been playing3B/5 figure them out help you out put them away clean it up the most expensive the best5/5 I’m not quite sure what you’re getting at. /Exactly./Do you mean that/NO,that’s not what I mean./ Could you go over it again? / Are you saying that测试LISTENING1/4 howdoes对He listened he wants to2/4 says he hasn’t heard of Kicks shoesto help Nickeye color3/4 Spread on the mustard:1.Put on the cheese and avocado.13楼 2. Put on the tomato and cucumber3.Add the secret ingredient.4/4 Gomez对if her team The team appearingVOCABULARY—————1/4 Marcello:Hi,Amy: pulled it off pass on2/4 Talia:Hi,Mom: Keep cool play it by ear3/4 come up with break down4/4 out of control out of this worldGRAMMER—————1/4 the luckiest pick him up best for dream this up2/4 Tony:So,Talia: think of working could start was doing as difficult as 3/4 Secretary: may to talk as easy as will give 4/4 interesting to buy surprised to invite havePRONUNCIATION1/5 up out2/5 I want to get and it3/5 single sound spr…… gl……4/5suprised going5/5 I have to has is —————SPEAKING1/3 Yes,what do you neeed I really need to2/3 Are you saping it Yes, that’s whatI mean3/3 Are you saying it didn’t go well Yes,that’s what Imean 过级最终测试Level Test—————listening1/5talia thinks…eliminated—the soccer teamthere is a rumor—has an injurytony thinks nick—a good soccer2/5what does the coach say the socer—they want nick not to palywhat does the coach ask to be—he doesn`t trustwhat dose nick say the tv station—he planned ahead3/5nick says his life is—a messnick says he needs—the newsdean doesn`t want to—comment about nicknick agreed to endorse—shoes4/5OK, I’m wondering…:couple sit-down silverware accommodateeasy-going understanding favor attractive settingsshe knows it’s kind of out of your way for us to go to this party Pick(注意大写) up anything else get somesome wine or dessert or bring anything5/5Alex.My old boyfriend Alex.:I looked really good toolook your bestNo way doing things and moving onhang out or somethingvocabulary1/6talia:i`mtry,but—truthamy:what`swrong,talia?—exhautedamy:you need to rest more—easy2/6which phrase means to want to do something?—feel like doing someting Which phrase means to understand something?—get itwhich word describes a loud way of speaking?—roar3/6dean:well i can tell you—reactionshoutthrough it4/6patty:he`s innocent—out of the waytalia:i know—dream uppatty:i can`t believe—wait and see5/6two boys were caught smoking—let them offexcuse us for a minute—asking to step asidethe government is tring to—downwe…for lost time by—made up6/6figure out—be able to come up withtake your time—don`t hurrythrow a game—plan to lose a sports gamegrammar1/4Tony:I(选词) : want am having would rather anyone better nick:i don`t know what to do—through itdean:i can`t believe all of—shout2/4dean:itink nick should—couldcoach:at first—was hoping3/4patty:well,i could add—hold on secondnick:thanks,i appreciate—best4/4talia:i…to see nick—havedean:why do you need to see him?—to talkdean:i think he`s too busy—concernedpronunciation1/6falling rising falling2/6forget debts talk3/6men{tion} ab{so}lutely4/6He…stuty—used to can’t5/6(br)eak (str)eet6/6looked—single sound talented—extra syllablespeaking1/2mark:what do you think about—frankly2/2but i`ve got one favor to ask you—ok.no problemhe was accused of taking drugs—yeah.absolutelyyou won`t believe who i ran into today—whoif you go shopping with me—that sounds goodyou studied so hard on the test—no.i didn`t prepare for it at all。
新编大学英语3视听说1~4单元听力原文与答案
Unit 1Part oneListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela:Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian. Interviewer: That sounds complicated. Could you explain what you mean? Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home. Interviewer: Do different cultures have different ideas as to what is polite? Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person? Angela: Yes, but sometimes I don't know who I am.Exercise 1 1. F 2. F 3. T 4. F 5. T 6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silent Listening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Exercise 1 1. sensitive/ caring independent / understanding 2. good friend 3. life people 4. learning being awareExercise 2 1. B 2. C 3. A 4. D 5. BPart Three More ListeningPractice oneTom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different. Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she hasa tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 1 1. ice-skating 2. chemistry 3. outgoing bright funny 4. moody self-centered 5. wavy blond medium height 6. unner-upExercise 2 1. T 2. F 3. T 4. F 5. F 6 TPractice twoDavid:Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl. David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.Exercise 1 1. Four 2. Colleagues 3. Teacher 4. Susan 5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter A G IPractice Three1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 1 1. Pedro energetic 2. Mr. Miller patient 3. Mr. Smith honest 4. Jake stubborn 5. Mrs. Duke creativePractice FourA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help. Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself. Statements1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitor a lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 1One day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection IITom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. T aylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. T aylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window,admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything. Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. T aylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. T om, I think you'd better get on with your homework!1. B2. B3. D4. B5. D6. A7. C8. BSection II I(S1 = the first speaker; S2 = the second speaker; S3 = the third speaker; S4 = the fourth speaker)S1: In this week's edition of Up with People we went out into the streets and interviewed a number of people. We asked a question they just didn't expect. We asked them to be self-critical...to ask themselves exactly what they thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard.S2: Well...I...I don't know really...it's not the sort of question you ask yourself directly. I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretary by the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street... Well...then I see someone a bit different. Yes...I'mdifferent in my private life. And that's probably my main fault I should say... I suppose I'm not coherent in my behavior. My office is always in order...but my flat! Well...you'd have to see it to believe it.S3: Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4: Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven. I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.1) secretary 2) hard-working 3) efficient 4) private 5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneListening IMart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I had this good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I should send her out there. It was a cold day in the fall. Well, she took right off and away she went. But she didn't show up when it got dark. I began to worry about her.She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and see if I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was this dog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth." Exercise 1 1. B 2. B 3. A 4. B 5. CExercise 2 1. T 2. F 3. T 4. T 5. F 6. TListening IIThere was an old man who had a daughter. He told his daughter that he had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten them all up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen his knife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papainvites preachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled to the preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these." Exercise 1 1. A 2. A 3. B 4. C 5. CExercise 2 1. T 2. F 3. T 4. T 5. F 6. FListening II IJack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat. So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his wooden one. In no time, that cat had eighteen mice piled up in front of the mouse hole.Exercise 11) stayed around 2) mouse catcher 3) rats and mice 4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat 9) managed 10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice oneKen: Hey, Josh. Where did you get those comic magazines?Josh: When I went home last weekend, I found these old Superman magazines that my older brother had bought many years ago.Ken: You don't have time to read old comics. Why did you bring them here?Josh: In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken: Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh:When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken: How?Josh: Superman is an orphan who comes by rocket to Earth when his native planet explodes. He lands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work and considerationfor others. As an adult, he migrates to a large city and defends Americans against evil. Ken: What else?Josh: Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken: But how does that relate to Superman?Josh: He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values of honesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken: I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh: OK.Exercise 1 1. B 2. A 3. A 4. C 5. DExercise 2 1. F 2. T 3. T 4. F 5.T 6 F 7. F 8.TPractice twoAt one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs instead of only for food.Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painful stiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you." The spirits of the deer would run to the place where a deer had been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If the answer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again. Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them. When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a cure for one of the diseases which animals had caused for mankind.This was the beginning of plant medicines from nature among the Cherokee Indians a long, long time ago.Exercise 1 1. C D J 2. A E G H 3. B F IExercise 2 1. A 2 .B 3. D 4.C 5. B 6. DPractice ThreeEvery March, a flock of buzzards returns to the town of Hinkley, Ohio. No one really knows how long this event has taken place, but according to local legend the annual buzzard migration began nearly 200 years ago with a massacre."The first legend of buzzards in Hinkley, Ohio, goes back to the Great Hinkley Hunt on December 24, Christmas Eve, in 1818. The local settlers deciding that the township needed to be made safe for their livestock, gathered together about 400 men and boys, with guns and clubs and completely surrounded the township of Hinkley."As the story goes, the townsfolk began marching toward the center of town, driving all the game in front of them, and killing virtually every wild animal they encountered. "The settlers took some of the deer and the wild turkeys for the holiday dinners, but left all of the other dead animals out in the snow. When spring came, the remaining dead animals attracted many buzzards, and since 1819 they've been coming back here in March."Hinkley locals have come to appreciate the buzzards' annual return. In mid-March, on Buzzard Sunday, they celebrate the birds' arrival with costumes, exhibits and songs. Exercise 1 1. B 2. D 3. C 4. D 5. AExercise 2 1. F 2. T 3. F 4. F 5.F 6. TPractice FourAlmost seven centuries ago, in Central Asia, there lived a great king called T amerlane. He was a mighty, powerful, conquering soldier, and his greatest ambition was that one day he would rule a massive empire stretching from the Atlantic Ocean in the west to the Pacific Ocean in the east. He made his imperial capital in the oasis city of Samarkand, which he planned to make the most beautiful city on earth. Many magnificent mosques were built and they were decorated with exquisite blue ceramic tiles on the outside, and with pure gold on the inside.Tamerlane, like the great oriental king that he was, had many wives, including a Chinese girl called Bibi Khanym. Now Bibi Khanym was the most beautiful of all T amerlane's wives, and she was also the youngest. She was his favorite wife and was deeply in love with him.In order to demonstrate her great love of Tamerlane, she decided to build a magnificent mosque to honor him, while he was away fighting in a distant war. She engaged the best architect, who designed for her the most magnificent mosque you could imagine. And then she found the best master builder, who began work immediately. But as the weeks and months passed by, the master builder began to fall in love with Bibi Khanym. She resisted all his advances, but at last he threatened to leave the mosque unfinished unless she allowed him to kiss her just once. Bibi Khanym wanted the beautiful mosque finished more than anything else. She was expecting Tamerlane to return any day. So at last she agreed to let the master builder kiss her, just once.But that was her terrible mistake, for so powerful was the master builder's love for BibiKhanym that when he kissed her he left a permanent mark on her face.King Tamerlane returned and saw the guilty mark on his wife's face. The master builder was executed immediately, and then, thinking that a woman's beauty can be a dangerous thing, Tamerlane ordered that from that day on all the women in the kingdom should never be seen in public without a veil to cover their face.Exercise 1 1. B 2 . C 3. B 4. A 5. D 6. AExercise 2 1. F 2. F 3. T 4. T 5.FPart Four Testing YourselfSection 1Long long ago, there was a pretty girl named "Red Riding Hood" because she was always wearing a red hood. One day her mother asked her to take some snacks to her grandmother because her grandmother was ill. Her mother told her, "Don't hang around on your way. Don't leave the main road."On her way, she saw a wolf. The wolf asked her where she was going and she told him that she was going to her grandmother's house. The wolf thought to himself how delicious she would taste. Red Riding Hood danced in the woods, picking flowers for her grandmother and forgetting what her mother had said to her.The wolf went to the grandmother's house and ate up the poor lady. Then he waited in the bed for Red Riding Hood.As Red Riding Hood came into the grandmother's house, she found her grandmother looked rather strange with very large ears, eyes, hands and mouth. And suddenly the wolf jumped out of the bed and devoured the little girl.。
新编大学英语视听说3Unit1听力原文和答案备课讲稿
Unit 1Part OneListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian.Interviewer: That sounds complicated. Could you explain what you mean?Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to what is polite?Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person?Angela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you suffer and cry for people you don't know, or over a movie that’s only a story, then I think that's a little too sensitive. That's the way I am.I am also a very independent person. I must do things by myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like; and I would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell others any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BListening IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody andself-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different.Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. self-centered5. blond medium height6. runner-upExercise 21. T2. F3. T4. F5. FListening IVDavid: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susan5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter A G IFurther ListeningListening IOne day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) swearing 8) perfectly 9) wildly 10) beeListening IITom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. Taylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything.Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7. D8. C1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. Miller D patient3. Mr. Smith E honest4. Jake A stubborn5. Mrs. Duke F creativeExercise 21. favorite way to relax2. how to divide3. bad unripe4. stiff sore5. fastening a basketball hoopA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scot s’English 2) the friendliest people 3) much nicer than 4) English courtesy 5) no views on the matter/no comments on the matter。
新编大学英语视听说教程第三册答案
Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.d Exercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. d Practice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more; Asia; Africa3.position; natural resources; gone down; steady4.continue to rise5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5. travel around in6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionPart TwoListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice TwoExercise 1(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goalsExercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7. records8. agree9. by 10. sense 11. ourselves 12.inhabitSection II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a.。
新编大学英语视听说3Unit1听力原文和答案
3Unit1 听新编大学英语视听说力原文和答案Unit 1Part OneListe ning IIn terviewer: An gela, you were born in Korea but you've been living in Canada for a long time, have n't you?An gela: Yes, I was 10 years old whe n my pare nts immigrated to Can ada and「ve bee n livi ng here for 20 years now.In terviewer: Do you thi nk that bel onging to two differe nt cultures has affected your pers on ality? Angela: Yes, definitely. There are times when I think that I have two pers on alities. Depe nding on where I am and who「m with, I'm Korea n or 「m Can adia n.In terviewer: That sounds complicated. Could you expla in what you mean?An gela: Well, grow ing up in Can ada whe n I was going to high school, for example, I was known as An gela to the outside world, and asSun-Ky ung at home. I would wave hello to my teachers, but bow to my pare nts' Korea n frie nds whe n they visited our home.In terviewer: Do differe nt cultures have differe nt ideas as to what is polite?An gela: Yes, defi nitely .In high school, I was expected to look straight in the eyes of my teachers and to talk ope nly with them. But whe n Korea ns spoke to me, I was expected to look at my feet and to be shy and sile nt.In terviewer: Do you thi nk that hav ing two pers on alities makes you a richer pers on?An gela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello4) bow5) look straight in the eyes of 6) ope nly 7) look at my feet8) shy and sile ntListe ning III am a very sen sitive pers on, and that's good to a poin t. I feel every one should be able to feel or un dersta nd what others are going through. But whe n you suffer and cry for people you don't know, or over a movie that s 6nly a story, then I think that's a little too sen sitive. That's the way I am.I am also a very in depe ndent pers on. I must do things by myself. I don't like people doing things for me, or helpi ng me, or givi ng me thin gs. It's not that I don't appreciate it. I just feel that whe n some one does somethi ng for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone any thi ng.I thi nk I would be a good frie nd. I would do almost any thi ng for some one I like; and I would share orgive any thi ng I have. I'm very cari ng and understanding. People trust me with their secrets, and they're right for doing so because I n ever tell others any secret that is told to me. 「m always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good.I find fun in almost everyth ing I do (except housework). I like to watch people, talk to them, and be around them. It makes no differe nee whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy lear ning and being aware of everyth ing and every one around me.Exercise 11. sen sitive/ cari ng in depe ndent / un dersta nding2. good friend3. life people4.learning being awareExercise 21. B2. C3. A4. D5. BListe ning IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Ci ndy and I are going ice-skati ng on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for n ext week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cin dy's sister, Kristi. We could double-date. She's really outgo ing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-ce ntered. She could n't stop talk ing about how great she was. I'm not sure if I can trust you, "Mr.Matchmaker".Bill: Oh come on. So I made a mistake last time. Ci ndy's sister is really differe nt.Tom: Well, what does she look like?Bill: Ah. Looks aren't importa nt. She has a won derful pers on ality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter tha n you are.Tom: Go on.Bill: She has a great figure, a nice complexi on, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kiddi ng. By the way, she was the runn er-up in the Miss California BeautyPagea nt two years ago. Well, you're probably notin terested.Tom: No, wait!Bill: Ah, just forget I ever men ti oned it.Tom: No, I'm in terested!Exercise 11. ice-skating2. chemistry3. outgoingbright funny 4. self-ce ntered5. blond medium height6. runn er-upExercise 21. T2. F3. T4. F5. FListe ning IVDavid: Barbara, before you go, could you tell me about these stude nts that are com ing into my class?Barbara: Oh, yes. Now, let me think, well,there's…er…Paul. He's a tall, slim lad with fair hair. Very frie ndly face, lovely smile... He's particularly good with group activities, and he's a very helpfulpers on to have in the class and very helpful with the other students. He speaks flue ntly, but does make a lot of mistakes! He does n't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susa n...Susa n. Now, she's very lively, quick, and very bright. She talks all the time but not always in En glish.David: What? Is she difficult or an ythi ng? Barbara: No…she's quite young but she does behave in quite a grow n-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very ni ce. She has dark hair and dark eyes.David: Right, well…are there any other girls in the class?Barbara: Y es, there is Maria. She's Susa n's sister.David: Y es.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has Ion ger hair tha n Susan. She's not quite as bright as her sister and I thi nk that makes her feel a bit in ferior really. Well, you know, she sulks a bit whe n she gets things wrong or she misun dersta nds you. But on the whole, a very sen sible girl.David: OK.Barbara: And the n there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brow n hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determ ined to lear n as much as possible. He asks quite difficult questi ons but he does n't mean to be n asty.David: Well, tha nks, Barbara. It's all up to me now, is n't it? Have a good holiday, won't you?Barbara: Tha nks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susa n5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter AG IFurther Liste ningListe ning IOne day, whe n Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sen sible tha n his wife, so he started to give her a lecture on the importa nee of always remai ning calm.Fi nally he said, "It's a waste of your stre ngth to get excited about small thin gs. Train yourself to bepatie nt, like me. Now, look at the fly that has just Ian ded on my no se. Am I gett ing excited or anno yed? Am I sweari ng or wavi ng my arms around? No. I'm no t. I'm perfectly calm."Just as he had said this, Mr. Smith started shouti ng. He jumped up and bega n to wave his arms around wildly and swear terribly. He could n't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sen sible 3) lecture 4) calm 5)stre ngth6) Ianded 7) swearing 8) perfectly 9) wildly 10) beeListe ning IITom: Oh, that Mr. Taylor. He is so bori ng! Mother: What do you mean?Tom: His less ons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darli ng?Tom: Yes, he gets angry very quickly.Mother: That does n't sound like Mr. Taylor at all!Tom: And do you know, he spe nds all the time look ing at his reflecti on in the win dow, admiri ng himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And con ceited! He thinks he knows everythi ng.Mother: Oh, Tom. Be reas on able. I'm sure you're exaggerati ng. Mr. Taylor seems such a ni ce, kind man.Tom: Well, he isn't. He is mea n and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I un dersta nd. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7.D 8. CListe ning III1. Pedro sleeps only six hours a ni ght. He goes to school full-time and works part-time in theafter noons. At ni ght he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of pers on is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The stude nts did n't un dersta nd. He had to repeat his less on and expla in the idea more slowly. Over the next few days heexpla ined and expla ined the less on un til almost the whole class un derstood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street n eighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom.Each one saw the chair he wan ted to sit on. Unfortun ately, it was the same chair. They both sat dow n at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, the n you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of pers on is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She faste ned a basketball hoop over the wastebasket. Now the stude nts love to practice throwing their paper into the basket. When they miss, they pick the paper up and try aga in. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. MillerD patie nt3. Mr. Smith E ho nest4. Jake A stubbor n5. Mrs. Duke F creative Exercise 21. favorite way to relax2. how to divide3. bad un ripe4. stiff sore5. faste ning a basketball hoop Liste ning IVA nu mber of visitors to the UK, who had traveled throughout the British Isles, were asked by a n ewspaper reporter what their impressi ons of the British people were. Here's a brief summary of what they thought.There were many differe nt opinions among those in terviewed: Some were very flatteri ng, others very critical. The distinction between the En glish and the British was n't always un derstood, but, onthe whole, it seemed that the Scots were very popular with visitors. They were thought to be very frie ndly, eve n though one Dutch visitor con fessed she'd found it hard to un dersta nd their En glish.A great n umber found the British gen erally reserved, particularly the En glish, although one Australian visitor called the English "the frien dliest people in the world and most hospitable". But she did admit that speaking the same Ian guage was a great help.Some Asia n bus in essme n, who had traveled widely throughout En gla nd, said quite ope nly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much ni cer", one of them said, with a playful smile on his face, "By much ni cer I mea n much more like us!"A few con ti nen tals praised "En glish courtesy", but the majority found it dish on est and dull."Yo u're forever say ing 'please' and 'sorry' whe n you don't feel pleased or sorry," one expla in ed.A young stude nt from South Africa had no views on the matter. He had n't met anyEn glishme n, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scots' English 2) the friendliest people 3) much nicer than 4) En glish courtesy 5) no views on the matter/ nocomme nts on the matter。
- 1、下载文档前请自行甄别文档内容的完整性，平台不提供额外的编辑、内容补充、找答案等附加服务。
- 2、"仅部分预览"的文档,不可在线预览部分如存在完整性等问题,可反馈申请退款(可完整预览的文档不适用该条件!)。
- 3、如文档侵犯您的权益，请联系客服反馈,我们会尽快为您处理(人工客服工作时间：9:00-18:30)。
Unit 1Listen1_Ex1Interviewer:Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela:Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer:Do you think that belonging to two different cultures has affected your personality? Angela:Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian.Interviewer:That sounds complicated. Could you explain what you mean?Angela:Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer:Do different cultures have different ideas as to what is polite?Angela:Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer:Do you think that having two personalities makes you a richer person?Angela:Yes, but sometimes I don't know who I am.1.Angela immigrated from Canada to Korea.(F )2.Angela is about 20 years old now.(F )3.Angela had two different personalities,one at school and one at home.(T )4.Sun-Kyung is Anglela's gilefriend at school.(F )5.Angela agrees that culture affects personality.(T )6.Being expected to two different cultures is sometimes confusing.(T)1) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListen2_Ex1I am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (excepthousework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.1.The man is very_and_person.2.He also thinks he would be a__ __.3.He enjoys __ and__,which makes him feel good.4.He enjoys __and__,which makes him feel good.1.sensitive independent2. good friend3. life people4. learning being aware1.In the man's opinion,it is good to (be a bit sensitive).2.The man doesn't like others to do things for him because (he doesn't want to owe others anything).3.The man says he can be a good friend because (he can keep his friends' secrets).4.One thing that the man doesn't like to do is (to do house work ).5.We can infer from the passage that the man is (sociable).Practice1_Ex1_Tom:Hey, Bill. Do you have any plans for this weekend?Bill:Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom:Oh.Bill:Why do you ask?Tom:Well, I thought you might want to come over and study for next week's chemistry test. Bill:Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom:Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill:Oh come on. So I made a mistake last time. Cindy's sister is really different.Tom:Well, what does she look like?Bill:Ah. Looks aren't important. She has a wonderful personality.Tom:Right.Bill:Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom:Go on.Bill:She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom:A what?Bill:No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom:No, wait!Bill:Ah, just forget I ever mentioned it.Tom:No, I'm interested!1. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. runner-upExercise 21.It can be inferred that Tom works harder than Bill.(T)2.Tom didn't like the first girl introduced by Bill because that girlT was not pretty.(F)3.Even though Tom agrees that looks are not important,he is still interested in knowing what Kristi looks like.( T)4.Tom is not interested in dating Kristi after listening to Bill's introduction of her.(F)5.Kristi has a tattoo of an eagle on her arm.( F)6.It can be inferred that whether a person is likeable or not is closely related to her.(T)Practice2_Ex1_David:Barbara, before you go, could you tell me about these students that are coming into my class?Barbara:Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas. David:Good.Barbara:Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David:What? Is she difficult or anything?Barbara:No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David:Ah, right.Barbara:She's very nice. She has dark hair and dark eyes.David:Right, well...are there any other girls in the class?Barbara:Yes, there is Maria. She's Susan's sister.David:Yes.Barbara:Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David:OK.Barbara:And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David:Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you? Barbara:Thanks.David:Bye.1.How many students are mentioned in the dialog?2.What is the probable relationship between the two speakers?3.What is the two speakers' occupation?4.Who's smarter,Maria or Susan?5.Who's going on holiday?1.Four2. Colleagues3. Teacher4. Susan5. Barbara\1) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IA.has moustache and wears glasses.B.has dark hair and dark eyes.C.feels inferior to Susan.D.speaks first and thinks later.E.has a friendly face and a lovely smile.F.does not always talk in English.G.is determined to learn,and takes notes all the time.H.has longer hair,and is plumer.I.asks quite difficult questions,but doesn't mean to be nasty.J.has lots of interesting ideas.Practice3_Ex11. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?1.Pedro _______2.Mr. Miller ______3.Mr.Smith______4.Jake______5.Mrs.Duke_______1. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice4_Ex1A number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself.Statements:1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitor a lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors.1) F 2) T 3) F 4) F 5) T1)flattering 2) critical 3) popular 4) reserved 5) EnglishSection1One day, when Mr. Smith came home from work, he found his wife very upset about something.Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection IITom:Oh, that Mr. Taylor. He is so boring!Mother:What do you mean?Tom:His lessons put me to sleep. And he's so quick-tempered, Mum.Mother:Quick-tempered? Mr. Taylor? Are you sure darling?Tom:Yes, he gets angry very quickly.Mother:That doesn't sound like Mr. Taylor at all!Tom:And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother:Really? And why does he do that?Tom:Because he's vain, that's why! And conceited! He thinks he knows everything.Mother:Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom:Well, he isn't. He is mean and cruel.Mother:Cruel? Now how can a history teacher be cruel?Tom:Because he only gave me two out of ten points in my history test.Mother:Oh, now I understand. Tom, I think you'd better get on with your homework!1.What is the probable relationship between the two speakers?(Mother and son)2.What does the boy say about his history teacher?(He is vain)3.According to the boy,the history teacher_______?(spends a lot of time admiring himself in the window)4.How does the woman respond to the boy's remarks?(She was doubtful)5.What is Mr.Taylor like in the woman's eyes?(He seems a nice and kind man)6.What does the woman mean when she finally says "Oh,now I understand"?(She understands the reason why the boy dislikes Mr.Taylor)7.What do we know about the boy's study of history?(He is not good at it because he doesn't work hard enough)8.What can we infer from the dialog?(Whether students like a certain teacher has something to do with their performance in that subject)1.B2. B3. D4. B5. D6. A7. C8. BSection IIIS1:In this week's edition of Up with People we went out into the streets and interviewed a number of people. We asked a question they just didn't expect. We asked them to be self-critical...to ask themselves exactly what they thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard.S2:Well...I...I don't know really...it's not the sort of question you ask yourself directly. I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretary by the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street... Well...then I see someone a bit different. Yes...I'm different in my private life. And that's probably my main fault I should say... I suppose I'm not coherent in my behavior. My office is always in order...but my flat! Well...you'd have to see it to believe it.S3:Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4:Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven. I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond 8) independent9) shy 10) fifteenUNIT2Listen1_Ex1Mart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I had this good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I should send her out there. It was a cold day in the fall. Well, she took right off and away she went. But she didn't show up when it got dark. I began to worry about her. She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and see if I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was thisdog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth."1.What did Mart go out hunting for?(Ducks)2.What was the weather like that day?(Cold)3.Who went with him?(His dog)4.What happened to Mart during the hunt?(The dog disappeared)5.How many dogs did Mart get in the end?(Eight)1.B2. B3. A4. B5. C1.Mart Moody was a good hunter.(T)2.The dog refused to get the ducks because of her pregnancy.(F)3.The dog didn't return home with Mart that night.(T)4.Mart went to look for the dog the next morning.(T)5.The dog gave birth to three pups.(F)6.The dog and her pups got ten ducks altogether.(T)1. T2. F3. T4. T5. F6. TListen2_Ex1There was an old man who had a daughter. He told his daughter that he had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten them all up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen his knife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papa invites preachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled to the preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these."1.Whom did the father go to meet?(A preacher)2.What did the father tell the daughter NOT to do ?(Eat the ducks)3.What did the daughter do after her father left?(She tasted the ducks)4.What did the father do first after he came back?(He sharpened the knife )5.According to the daughter,what would the father do to the preacher?(He would cut both his earsoff)1. A2. A3. B4. C5. C1. T2. F3. T4. T5. F6. FListening IIIJack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat.So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his wooden one. In no time, that cat had eighteen mice piled up in front of the mouse hole.1) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningKen:Hey, Josh. Where did you get those comic magazines?Josh:When I went home last weekend, I found these old Superman magazines that my older brother had bought many years ago.Ken:You don't have time to read old comics. Why did you bring them here?Josh:In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken:Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh:When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken:How?Josh:Superman is an orphan who comes by rocket to Earth when his native planet explodes. He lands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work and consideration for others. As an adult, he migrates to a large city and defends Americans against evil.Ken:What else?Josh:Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken:But how does that relate to Superman?Josh:He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values of honesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken:I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh:OK.Practice One Exercise 11.Why does Josh read comic magazines about Superman?(For his literature class)2.What does Josh think of Superman as?(A hero)3.What does Superman represent according to Josh?(American values)4.Why does Josh think Superman is so special to the Americans?(Because he is an immigrant just like most other Americans)5.What is Josh going to write about Superman?(A paper)1. B2. A3. A4. C5. DExercise 21.Josh got the magazines from an old bookstore.(F)2.Johnny Appleseed planted apple trees in the Midwest many years ago.(T)3.Superman was not born on Earth.(T)4.A wealthy couple adopted Superman and taught him American values.( F)5.Superman moves to a large city when he grows up.(T)6.The only job of Superman at the newspaper agency is to fight against evil.( F)7.Josh's great grandparents came from Brazil.(F)8.Paul Bunyan is another legendary figure in American history.(T)1.F2.T3. T4. F5.T 6 F 7. F 8.TPractice TwoAt one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs instead of only for food. Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painful stiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you."The spirits of the deer would run to the place where a deer had been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If the answer was "yes", thespirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again.Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them.When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a cure for one of the diseases which animals had caused for mankind.This was the beginning of plant medicines from nature among the Cherokee Indians a long, long time ago.1.C D J2. A E G H3. B F IA.They decided how man should be punished.B.They would provide medicine for man's illnesses.C.They hunted deer for food and clothing.D.They would suffer painful stiffness in their bodies.E.Their spirits would track the hunter to his home.F.They were friendly to man.G.They were angry at their treatment by man.H.Their leader sent a message to the Cherokee Indians.I.They had a meeting of their own.J.They had mistreated the animals.Exercise 21.Which word can best describe the man-animal relationship at first?(Peaceful)2.Why did man start to destroy animals?(For food and clothing )3.Why were deer chosen to decide how to punish man?(Because they were most often killed by man)4.Who would be punished by deer?(Deer killers without asking pardon first)5.What was the punishment?(The hunter would be made crippled)6.Why did the plants decide to help man?(Because they thought the punishment was too severe) 1.A 2 .B 3. D 4.C 5. B 6. DPractice ThreeEvery March, a flock of buzzards returns to the town of Hinkley, Ohio. No one really knows how long this event has taken place, but according to local legend the annual buzzard migration began nearly 200 years ago with a massacre."The first legend of buzzards in Hinkley, Ohio, goes back to the Great Hinkley Hunt on December 24, Christmas Eve, in 1818. The local settlers deciding that the township needed to be made safe for their livestock, gathered together about 400 men and boys, with guns and clubs and completely surrounded the township of Hinkley."As the story goes, the townsfolk began marching toward the center of town, driving all the game in front of them, and killing virtually every wild animal they encountered."The settlers took some of the deer and the wild turkeys for the holiday dinners, but left all of the。