新编大学英语视听说3纯答案版
新编大学英语视听说教程3答案
新编大学英语视听说教程3答案1. A: What did you think of the movie we watched last night?B: I found it quite captivating. The storyline was unique and the acting was superb.2. A: Did you attend the lecture on climate change?B: Yes, I did. The speaker provided a lot of insightful information and raised awareness about the urgency of addressing this issue.3. A: Why did you choose to study psychology?B: I have always been fascinated by the human mind and behavior. Psychology allows me to understand and help people better.4. A: Have you read the latest novel by your favorite author?B: Not yet. I'm currently in the middle of another book, but I'm looking forward to starting it soon.5. A: How was your interview for the internship?B: It went well, I believe. I was able to showcase my skills and experiences effectively and I had a positive rapport with the interviewer.6. A: What do you think are the key factors for successful teamwork?B: I think effective communication, mutual respect, and a shared goal are crucial for successful teamwork.7. A: Did you enjoy the concert last night?B: Absolutely! The band performed exceptionally well and the atmosphere was electric.8. A: How do you manage your time effectively as a student?B: I make use of a planner and prioritize my tasks. I also try to eliminate distractions and set realistic goals for myself.9. A: What are your thoughts on the use of technology in education? B: I believe that technology enhances the learning experienceand provides opportunities for personalized and interactive learning.10. A: Have you ever traveled to any foreign countries?B: Yes, I have. I have been fortunate to visit several countries, and each experience has been eye-opening and enriching.。
【精品】新编大学英语第三版视听说3听力答案(Unit1-Unit6)
Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问,应选C,请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √ 2×3×4√Jack 1 √ 4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11.FTFT2.South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1)import from abroad 2)sales manager 3)salary 4)sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√C×D√E×F√G×H√I√J2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√B×C√D√E×F√G×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1:Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2:1.1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√ 5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1)a.whales and dolphinsb.birdsc. tigers2)a. meat oilb.handbags shoesc.furd.ivory2.TFTT。
Removed_新编大学英语视听说教程3答案
4) Peter A G I
Practice Three Exercise 1
1. Pedro energetic
2. Mr. Miller patient
3. Mr. Smith honest
4. Jake stubborn
5. Mrs. Duke creative
Practice Four Exercise 1
6. unner-up
Exercise 2
1. T 2. F 3. T 4. F 5. F 6 T
Practice Two Exercise 1
1. Four 2. Colleagues 3. Teacher 4. Susan 5. Barbara\
Exercise 2
1) Paul D E J 2) Susan B F 3) Maria C H
1. T 2. F 3. T 4. T 5. F 6. F
Listening III Exercise 1
1) stayed around 2) mouse catcher 3) rats and mice
Part Two Listening I Exercise 1 1. B 2. B 3. A 4. B 5. C Exercise 2 1. T 2. F 3. T 4. T 5. F 6. T
Listening II Exercise 1
1. A 2. A 3. B 4. C 5. C
Exercise 2
Unit 1 Part One Exercise 2 1. Mike C 2. Sam E 3. Ted D 4. Simon A 5. Lilly B Exercise 3 1. avoid power 2. social outgoing 3. reputation 4. despite wittiest 5. make up for protective 6. describes 7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristics
新标准大学英语视听说第三册答案完整
Unit 1Inside ViewConversation 1Exercise 2:1. Janet is not going back to China.2. It is in the middle of summer.3. Janet is going to work for London Time Off, a website about London.4. Joe is Janet’s boss.5. Janet doesn’t know what she is going to do.6. Joe and Andy do not agree that New York is the greatest city. Exercise 3Conversation 2Exercise 55-6-2-3-8-7-4-1Exercise 61. don’t mind my asking2. he drives me crazy3. what do you mean by4. it’s the last thing5. we check out new events6. the musicians or the actors7. can I ask you something else8. we’ve got an interview to do9. supposed to be on his wayExercise 7B B B A A BOutside ViewExercise 24-5-1-3-2Exercise 3B C C A AExercise 51. b d f2. a e3. g4. cExercise 61. So that they can learn something about themselves2. It can lead to a higher self-consciousness3. It can lead to happiness4. A strengthening of the personality5. “Who am I as a person? Am I really happy?”6. He think students can get indications of happiness from teachers.7. Happiness scientists.8. They don’t write definitions on the board.Listening inPassage 1Exercise 2C D A BExercise 3:1. tolerant, rounded2. close to, stand up3. beauty, generosity4. an opportunity, beyond the one5. behaved, selfish6. pretend, see through7. arrived in, had to help8. difficult time, a huge amount ofPassage 2Exercise 61. Joan is an academic counsellor at Manchester University.2. She is talking to a presenter and callers for a radio program.3. It is important, because their choices of subject are likely to have an impact on their future careers.4. He wants to work in IT.5. Not at all.Exercise 71. strengths, weaknesses, personality, like, subjects, organized, confident, outgoing, a team, working alone.2. future careers, into a particular area of work, chosen field, related industries, leading3. vocational, graduates, high-flyers, career, practical, transferable, recruitmentUnit2Inside viewConversation 1Exercise 3:1.in Southwark, which is part of London2.About 120 years old3.it used to be raised three or four times a day4.not so often5.in the late 1980s and 1990s6.in the 1960sExercise 41.she’s really impressed.2.Because they couldn’t go under London Bridge.3.Just on this side of London Bridge.4.He remembers that many buildings were damaged from the war.5.They used to take you to the hospital because the water was so polluted.6.It is one of the cleanest city rivers in the world.Conversation2Exercise 6b b b d d aExercise 71.The thing about2.It’s amazing3.Let me see4.Anyway,where was I?5.You were telling me about6.That’s fascinating7.Let me thinkExercise 8b a b b bOutside viewExercise 24-3-6-1-5-2Exercise 31.where there is war2.go to school3.working in 157 countries4.has never known peace5.bringing medicine6.get an education7.40000 kids8.girls were not allowed9.50 percent10.running the school for 12 yearsExercise 41.d g2.e3.c4.f5.a6.bExercise 51. d2. a3. b4. b5. aListening inPassage1Exercise 21.her husband2. a church in the distance3.her favourite aunt(and uncle)4. a farm5.two(the speaker and her brother)6.about 147.20 yearsExercise 3c b a cd aPassage2Exercise 63-5-1-4-6-2Exercise 71.K(√)2.E(√)3.E(√)4.K(√)5.E(√)6.K(√)7.E(√)Exercise 81.Because he thought it would make him grown-up2.Because he was lying on the floor screaming and screaming3.Because she wanted to go home and she couldn’t get her coat on4.Because they used to fight (but actually,they’re just having fun)5.Because she had short blond hair.6.Because she had had some good times7.Because he wanted to get a job and earn moneyUnit3Inside viewConversation 1Exercise 21.He used to work in a theatre2.He moved the scenery between the acts in the play.3.She saw My Fair Lady4.To find out where Andy and Janet are ...or to check if they are going to be late.5.He’s a theatre critic.6.She has to check the sound levelExercise 31.Jan(√)2.Jan(√)3.A(√)4.A(√)5.Joe(√)6.A(√)7.Joe(√)8.A(√)9.Jan(√)10.Joe(√)Exercise 42 3 4 5 (√)Conversation 2Exercise 6b c d c aExercise 71.has just been to see2.Can you tell me something about it3.Tell me more about4.It sounds very unusual5.So it’s family entertainment6.did I do something wrong7.Did you remember to8.Hurry upExercise 8b b a a a aOutside viewExercise 21 5 7 9 10 (√)Exercise 31.most famous painting2.broke all the rules3.looking directly at4. a sense of movement5.indicated a real place6.what is she trying to say7.covered up one side of her face8.we’re the subject9.seemed happier10.the mystery about her11.line up between12.tell a storyExercise 41.A(√)2.S(√)3.S(√)4.S(√)5.A(√)6.S(√)7.S(√)8.A(√)10.A(√)11.S(√)12.A(√)Exercise 51.Her portraits and books both tell stories2.The character or performer of the images3.She is trying to capture a deeper essence of a person4.He uses a pinhole camera which requires a very long exposure5.She needs to work on the reflections in the water and the face of the boy6.He links them together with a string7.She tries to capture something about the soul,or essence ,of the person.8.It represents the process of decayListening inPassage1Exercise 21.The highlight was seeing the show Nanta2.It’s a live show :part theatre,part dance,part music.3.The music is a mixture of traditional Korean music,percussion and drums4.In 19975.Because it’s a non-verbal performance6.It’s set in a kitchen7.They use knives,dustbin lids and kitchen utensils8.Nanta means “random drumming” in Korean.Exercise 32 4 7 (√)Passage2Exercise 61.London2.New York3.1929,reopened 20065.Free6.20 US dollars7.8 euros8. 4.5 million9. 1 million10.211.3Exercise 7a c d c bUnit 4Inside viewConversation 1Exercise 21. They’re preparing to interview Janet’s friend.2. The interview is part of a background series to ethnic restaurants.3. The London Video Games Festival in Trafalgar Square.4. it’s very popular. About 100,000 people attended last year.5. They put up a huge tent where people could try out new video games.6. Because it’s very popular.Exercise 3B D A B BOutside view:Exercise 2B C B C D DExercise 31. wax and feathers2. got off the ground3. thrust, lift and control4. thrust5. the tail6. provide lift, control and thrust, and be light enough.Exercise 45-3-1-10-4-1-8-9-7-6Exercise 51. inventions2. develop and test3. helped them understand and study4. the shapes of different wings5. made the front steady6. controllable7. distance and duration8. 1,000 test flights9. flew the first powered airplaneListening inPassage 1Exercise 21. Work in office-based jobs2. People are not exercising their bodies and they are putting on weight.3. It is caused by long periods spent sitting at the computer.4. They ensure staff are sitting correctly at their computers and take breaks.5. It is caused by several factors: lack of natural air and light, having q lot of electronic devices and air-conditioning.6. They are installing better lighting and ventilation, increasing the number of plants and encouraging employees to take breaks.Exercise 31. 18%2. over 40%3. a/one fifth (20%)4. over a million5. roughly 30%Passage 2Exercise 6The true statements are: 2, 7 and 8.Exercise 71. the amount of the world’s farmland that is managed intensively2. the proportion of flowering plants that need to be pollinated in order to bear fruit3. the number of commercially grown crops that need honey bees4. the number of bees released by farmers in California to pollinate almond trees5. the time for a species of wild mango to bear fruit6. the time for a cultivated species of mango to bear fruitUnit 5Inside view:Conversation13.d g f a b c eConversation 25.1. so where do you call home?2. so how long has there been a Chinese community in London?3. And how did they make their living?4. And why did Chinatown move over here?5. And does it still feel like a traditional Chinese community?6.d b c b a7.1. I guess this is home2. how long has there been3. when the Chinese first came to4. they were also famous for5. at the start of the 20th century6. from all over London7. and does it still feel like8. along with the Chinese8. b b a b bOutside view2.1. it’s peaceful and quiet and just the place to relax.2. they fight3. during the mating season4. when they are on a crowded street or bus5. she’d be very angry and tell them to move.6. maybe throw a little sand in their face and make them move.7. move his towel next to them and start a conversation8. people can get a lot more aggressive9. she’s waiting until someone wants her parking space3. b c c d a5.1. he pulls into the parking space that the producer left2. because he was waiting first.3. anger management counseling4. because the radio in on5. a hearing problem6. he would beep the horn, roll down the window and shout very rude things at the person who took the space7. she would yell out of the window and tell them to move8. it is important for survival6.7-1-4-14-11-12-5-6-8-2-9-13-3-10inside view:passage 26.c b c c aUnit6Inside viewConversation12.she thinks it’s coldWoodA thatched roofA kind of dried grassThey standA report on the summer season at the Globe.Stratford-upon-Avon3.19971666There are some seats but most people stand MayAbout 130 kilometers4. d b c a cConversation26. The true statements are: 1,3,4,5 and 9.7.When was Shakespeare bornWhen did he dieWhen did he come to Londondon’t know exactlyWhat happened to him laterI reckon there are aboutWhat I think isI suppose it’s becauseI’m really stunnedI guess8. b a a bOutside view2.The true statements are : 1, 2 and 53. b c a b d4.I don’t like cyclingdo something goodsit on a couchand with two legslife on the roadthrow the bikeIt’s been differentPerforming marvelouslyListening in2.New YorkAfternoon15530 to 45 secondsnone57293.There were few injuriesCatch fireMade a successful landingTaking in waterhelped into the boatswere taken to hospitalsas a herowithout any engines6.PaulZoo keeperAl Goremaking people take climate change seriously GreenpeaceClaremum ,part-time accountantMelinda Gatesco-founding the Bill and Melinda Gates Foundation Save the Children7. The true statements are :1,5 and 7Unit7Inside viewConversation12. 5-3-2-6-1-43. c d d a b bConversation24.Topics actually mentioned are: steam engines, electricity, space rockets, satellites, computing, scientific experiments, agriculture, history of flight and telescopes.5.It’s got everything to do with science.She thinks it sounds fascinatingAt the museumShe tells him Andy and she are going to spend the night togetherJoe is surprised and confused6.Why is it so specialI suppose this ishave special exhibitions for kidsThe first thing you have to dowe’re really gonna stay the nightWhile you’re gettingWhere are you two off to7. b b b a bOutside view4. a d c a d5.areas of lifein our homescomputer-controlled housesadjust the temperaturegive new instructionsreact to matchTV and Internetoutside changesstop too much sun from entering turn the over onListening in2.carried out a two-month study About one in fourUnlike biscuits ,doughnuts Horizontally dunkingthe tea the fasterreleases up to ten times3.dunking biscuitsheld togetherabsorb liquidtravel throughhold the biscuitproducing a table6.By Peter:1,2,4,6 and 8By Louise:3,5 and 77. b b d a c a.Unit 8Inside viewConversation 12.1. most weekends2. every day of the week./ all week3. 10 am to 6 pm4. it gets pretty lively as people go to the pubs and restaurants all around.5. they sell pretty well everything6. it’s a famous club./ it’s one of THE great clubs in London7. to the electric Ballroom8. no, she doesn’t.3.the statements said by Janet are: 4 and 8the statements said by Andy are: 3,6 and 7the statements said by Joe are: 1,2 and 5conversation 27. a a b b blistening inpassage 26.Christmas: 1,6,8thanksgiving: 2,3,7Hogmanay: 4,57.1. because it’s a religious festival but she is not a religious person and so it doesn’t have that kind of meaning to her.2. it’s a good reason for families to get together, eat a lot of good food and five each other presents3. because it’s exciting to think that Father Christmas will come down the chimney and leave them presents4. it’s a time to give thanks for everything you have5. he says it’s probably as commercialized as Christmas.6. the shortest day of the yearUnit 9Inside viewConversation 12. The true statements are: 2 and 5.3. b c d c dconversation 25.1. royalty and landowners2. animals3. symbols taken from the bible4. objects5. places6. jobs7. myths and legends6.1. where was i2. you sound as if you know sth about3. where did I leave off4. ok, got you5. and let me see6. my mind’s gone blank7. if you’ll excuse me8. it was great talking to yououtside view2.photo 1: Elizabethphoto 2: Jamesphoto 3: Georgephoto 4: Victoria4. b b d a b clistening inpassage 12. 2-6-5-3-1-43.4.1. attractive, powerful, attractive, powerful2. to think of3. much too long4. meaning very small5. the best or the strongest6. most romantic lovers7. sound luxuriouspassage 27. the true statements are: 3, 4 and 68. c b c a dUnit 10Inside viewConversation 12.3.1. walking2. she doesn’t know anything about London3. some existed; some did not4. to have come to London with his cat to seek his fortune5. he was Lord Mayor of London four times6. we have no proof that he had a cat7. the ghosts of Londonconversation 25. b a b d c6.1. way to go2. that’s the way to do it3. l et’s hear it4. good for you5. thank you so much for your help6. couldn’t have done it7. we certainly did8. it’s extraordinary9. so what’s next7. b a b b aoutside view2. the true statements are: 1,3, and 43.1. in the present2. to trick people3. got sunscreen in his eyes4. eating bananas5. were descended from apes6. humans and animals4.1. the gravity reduction story and the Noah’s ark story2. the gravity reduction story3. the gravity reduction story was a hoax, the Noah’s Ark is tru e5.1. is based on a famous hoax2. would pass in front of3. at that moment4. the world was destroyed by a flood5. it is believed to be6. announced on the radio7. snow on the top of8. may or may not be Noah’s Ark9. we want to believe themlistening inpassage 12.1. d2. a, b, c3. e, f4. d5. c6. a7. e8. e3.1. the huge differences2. there was only darkness3. there was light’4. a small island5. Mother Earth6. a bird7. the sun, and the earth8. creation myth at allpassage 26. callers 1,3,4 and 5 believe in big cats7. b c d b d。
新编大学英语视听说3Unit1听力原文和答案
Unit 1Part OneListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian. Interviewer: That sounds complicated. Could you explain what you mean? Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home. Interviewer: Do different cultures have different ideas as to what is polite?Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person? Angela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you suffer and cry for people you don't know, or over a movie that’s only a story, then I think that's a little too sensitive. That's the way I am.I am also a very independent person. I must do things by myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciateit. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like; and I would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell others any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BListening IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different. Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. self-centered5. blond medium height6. runner-upExercise 21. T2. F3. T4. F5. FListening IVDavid: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.1. Four2. Colleagues3. Teacher4. Susan5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter A G IFurther ListeningListening IOne day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) swearing 8) perfectly 9) wildly 10) beeTom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. Taylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything. Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7. D8. CListening III1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. Miller D patient3. Mr. Smith E honest4. Jake A stubborn5. Mrs. Duke F creative Exercise 21. favorite way to relax2. how to divide3. bad unripe4. stiff sore5. fastening a basketball hoopListening IVA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help. Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself. Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scot s’ English 2) the friendliest people 3) much nicer than 4) English courtesy 5) no views on the matter/no comments on the matter。
新编大学英语视听说教程3外研出版社听力答案
新编大学英语视听说教程3外研出版社听力答案Key to Unit 3V ocabularyI 1 1)threatens 2) by a small margin 3) civilize 4) closed up 5) wandered6) paste 7) without so much as 8) sideways 9) hook up to 10) universal 11) chart 12) Bathed in2 1) narrowed down 2) looked back on 3) cut off 4) fit into 5) wear (the other) down 6) lies in 7) put up 8) stand for3 1) which is likely to make people vulnerable to asthma has been found by researchers at the Department of Clinical Medicine in Oxford.2) with mirrored doors had to be built in so as to make their small bedroom look larger.3) feature the space shuttle Challenger blowing up in January 1986----killing all seven crew.4) threatened to keep the pupils in after school they were quieted at once.5) are a major barrier to the country’s economic growth due to the fact that imported oil has absorbed 40% of tis foreign exchange (because imported oil has absorbed 40% of its foreign exchange)4 1) looked back on atmosphere urban life2) era hooked up to the the electronic3) the suburb a sophisticated system analyze make errorsII collocation1 away2 inside/in3 forward/through4 back5 off6 home7 back down8 in outIII usage1 Internet is not such an unusual word as it used to be2 Most men do not look unattractive in them3. Wealthy as she is, she is not unconcerned by her sudden unemployment4. This claim is not unrealistic in view of a sharp decrease in the city’s violent crimes5. His poor health is not unrelated to his unhealthy way of lifeComprehensive exercisesI cloze1 Text-related1 Statistics2 rural3 era4 stood for5 on the latch6 vulnerable7 barriers8 electronic9 reflection 10 civilized2 Theme –related1 tougher2 liable3 shift4 electric5 cautious6 sophisticated7 thieves8 break9 chances 10 signsII translation1 The Internet is changing the way people live, no matter whether they are in urban or rural areas.2 Medium-sized and small companies are more vulnerable to the threat of the global economic crisis than large ones.3 With regard to our term papers, the professor asked us to analyze the chart of unemployment first, and then provide critical relections on the nation’s economic development.4 It never occurred to him that their team would win the basketball match by a large margin.5 Looking back on my twenty years’ teaching in high school,I attributed my success to patience, talent, and the constant pursuit of knowledge.2 It is almost impossible to keep a determined burglar out. All you can do is discourage him for a few minutes, thus exposing him to police patrols. Common sense tells us that lighting is a barrier to criminal activity. A light should be fixed in the doorway and switched on at night. Make sure that you don't leave the door on the latch if you happen to be the last to come in. If you decide to buy a sophisticated electronic alarm system, be sure to ask for its signs and put them up on both windows and doors. In addition you may have it hooked up to a police station.。
新编大学英语视听说教程第三册标准答案
Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5.travel around in 6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice Two(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。
新编大学英语视听说教程第三册听力答案
Keys to the texts of book3Unit sixPart OneExercise 2 :1. d2. a3. b4.c5. c6. aExercise 31. farm animals; hold; feed2. small pets; toys3. buy; toss them out4. real shame5. dangerous; destructive ; bring diseases6. have a points7. humanely; limit8. time; money; warm place9. isolated; company 10. storm of debatePart TwoListening IExercise 11. b2. c3.d4. bExercise 21 T 2. F 3.F 4. F 5. T 6. TListening IIExercise 11.Her son.2. snake; crocodile3.quiet4.picky/particular Exercise 21. big2. dogs3.tiger4. bit5. cat6. friendly 6. eat 8. clear 9.wash 10.space 11. noisy 12. train 13. speak 14.keep 15. quietPart ThreePractice oneExercise 1(1,4,5,6,7,) yesExercise 21 a 2.b 3.c 4.a 5. dPractice TwoExercise 1(1,3)yesExercise 21. for free2.small donation3. 204. hundreds5. eat little6.50 7. animal shots 8. numerous shots 9. diseasesPractice ThreeExercise 11.c2.b3.d4.c5.aExercise 2(2,5.6.7) yesPractice FourExercise11 c 2.c 3. a 4.b 5. dExercise 21.crowding water; grass;2. what is happening; low3.targetpractice; over the area4. gotten rid of; stayPart Four Testing yourselfSection I1.f2. t3. f4. t5. f6. t7. t 8. f 9. f 10. tSection II1. a2. c3. d4. b5. b6. bSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5000 12. embarrassed 13. advertise the furs 14. export bans 15. importation 16.turtleKeys to the texts of book3Unit sevenPart OneExercise 2 :1. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery ;historic interest3. Summer ; too cold4. long history ; vast territory5. feed the monckys6. as many places as possible.7. you name it8.. host city ;ancient civilization; modern architecture9. city wall; treat yourselves 10.express train Part TwoListening IExercise 11 c 2. b 3. b 4. c 5. d 6. aExercise 21. SN 862 17:50 on July 112. SN863 15:10 on July 14 Listening IIExercise 1(B.C.F.G.H.I) yesExercise 2Part one 1.F 2. T 3.T 4.T Part two 1.F 2.F 3T 4.F Part three1.T2.T3.T .4.T5.FPart ThreePractice oneExercise 1Advantages: ADH ; disadvantages: EExercise 21 c 2.d 3.b 4. cPractice TwoExercise 11. seedypany3.shared4. noisy5. early6. private7. booking8. convenient9. restaurant 10.bathroomsExercise 21. T2. F3. T4. T5.6. TPractice ThreeExercise 11. Fuel2. Water3. Vehicles4. ClothesExercise 21.passing lorries 6. self-sufficient2.enough water 7. car repairs3.drinking 8. cost much4.vehicle 9. sweaters5.emergency 10. European winter Practice FourExercise1a. actress Bb. actress and author A1. a2.b3.b4. a5.b6. a7. a8. b Exercise 21.T . F 3. F 4. F 5. F 6. T 7. F 8.TPart Four Testing yourselfSection I1.F2.T3.T4. T5. FSection II My history teacher1. b2. c3. c4. c5. a6. dSection III1. d2. b3.c4. d5. aKeys to the texts of book3Unit eightPart OneExercise 2 :Section A5,7,1,4,6,3,2Section B1)F H I 2)A 3) C E J 4) B D G JExercise 31.passed out; in shock2. back and forth3. knows the reason why4. no doubt; living without her5. plays a great role6. brilliant boy7. very few cases8. deny; nature9. bright or not; should; CAN 10. thicker than; genetic relationship 11. react to; not to mention 12. hard decision; involvedPart TwoListening IExercise 11 F 2. F 3. T 4. F 5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed 8. language 9. young 10. alike 11. separated 12. apart 13. career 14. interestsListening IIExercise 11.b2.d3. a4. dExercise 2(1,4,6,8,10,11,12 ) yesPart ThreePractice oneExercise 1(3,6,9) yesExercise 21. six2. four3.1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice TwoExercise 11. 19212. fit the child3. ordinary schools4. adult conception5. BarbaraExercise 21. good being2.wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars 10. scholars 11. street cleanersPractice ThreeExercise 11. c2.b3. c4. bExercise 21 F 2. F 3. T 4. F 5. FPractice FourExercise11 a 2. c 3. d 4. aExercise 21.F2. T3.T4. T5.T6. TPart Four Testing yourselfSection I1.talent2.dancing3.creative4. early5. physical6. energy7. less8. curiosity9. particularly 10. cause 11. fundamental 12. meaning 13. superior 14. fluently 15. read 16. exceptional 17 preparation 18. fullySection II1.F2. T3. F4. F5. T6. F7. F8. TSection III1. c2. a3. c4. b5. dKeys to the texts of book3Unit NinePart OneExercise 2 :1. c2. c E3. .c4. w5. w 6 c 7. c 8. c 9.c 10. w 11. w 12. w 13. c 14. w 15. w 16. c 17. w 18. wExercise 31.prefer; old- fashioned2. as old as3. account for4.own; play; earn a living5. very proud of6. had the chance7. hills; small bridges; singing of birds8. full of energy9. holes; buttons; precise; notes 10.indirectly; individualistic 11. places great importance on 12. a universal languagePart TwoListening IExercise 11 restaurants, airports supermarkets; banks 2. attitudes; in the right mood ; a better feeling; the people around him; happy; work better 3. world war II 4. happy; calm ; a machine; kinds of music ; different times; faster ; slowerExercise 21. T2. F3.F4.T5.T6. F7. T8.FListening IIExercise 11.eases their minds; operations2. classical; instrumental Jazz;folk music 3. reduce tension; 50 male doctors; Mathematics ; 1. quickly 2. calmly 3. chosen for them 4. no music 5. the worst sleepyExercise 21. T2. F3.T4. F5. FPart ThreePractice oneExercise 11. b 19622.d 19633.a 19644. c 1970Exercise 21. their own style2. the nature3. sounds; experimented4. songs; records5. films ; awardsPractice TwoExercise 11. (1) (2) (3)2.(2) (1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the string5. manages the bowExercise 3.1. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice ThreeExercise 11. T2. T3. T4. F5. F6. F7. F8. TExercise 2。
新编大学英语视听说教程3听力标准答案
Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly BExercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. T Exercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 T Practice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection II1. B2. B3. D4. B5. D6. A7. C 8. BSection III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. C Exercise 21. T2. F3. T4. T5. F6. F Listening III Exercise 11) stayed around 2) mouse catcher 3)rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7.F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. D Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7.F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction4) species5) oxygen 6) economic 7) conservation8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa¥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ¥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. F Exercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. B Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.T Exercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by10. sense11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. A Exercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debate Part TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.D Exercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory10. reduced11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. A Exercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages E Exercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathroomsExercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7)A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. D Section III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5,7,1,4,6,3,2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.T Part Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16.C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makesthe notes4. on the strings5. manages the bow Exercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. TExercise 2Bruce Springsteen: communicative, direct, exciting, simplerSting: naturalPeter Gabriel:musicalBranford Marsalis: brilliant, humorous Youssou N’Dour:not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damaged Exercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. A Section II 1. C 2. B 3. D 4.A 5. B Section III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black11. white 12. shaking 13. wet 14. sweet15. delicious16. angel 17. grave 18. nights 19. days 20. taste。
新编大学英语视听说教程3 外研出版社 听力答案
UNIT 2Text A Freedom GiversV ocabularyI.1. 1) decades 2) historic 3) imposed 4) religious 5) slender 6) web7) bade 8) site 9) on the side 10) authorized 11) terminal 12) make the best of2. 1) went through 2) stood up for 3) laid down 4) take on5) let (us) down 6) draw on 7) fall into 8) pass for3. 1)The Europeans are fully confident that the Americans will not be able to justify their measures to protect the struggling American steel industry.2)Clinton is, in the eyes of Joe Klein, staff writer of the New Yorker and author of The Natural, the most talented politician of his generation and the most compelling.3)There's not much you can do if people are really intent on destroying themselves with drugs.4)A different experience of the world could forge a completely different approach to life.5)It is our conviction that cloning of human beings is bound to cause many ethical and social problems in the long run. 4. 1) As for, do not compel, capture of, have forged 2) At huge risk, the mission, shelter3) who abolished, In the eyes of, racialII. Words with Multiple Meanings1. I'll tell you in a minute how I have attained the genuine sense of belonging in America, but first let me hear about your French trip.2.Most McDonald's look almost the same on the outside, but actually there are about 16 differ-ent basic designs.3.Loaning money from the banks is but one of the methods we can use to get through a financial crisis.4.This second-hand car has been nothing but trouble; it's always breaking down.5.In your resume you've mentioned everything but one vital point.6.Our technicians have discovered a simple but effective solution to the problem.7.I am sorry, but I think you shouldn't have lingered on over coffee and missed the last bus..8.The bankruptcy of the company was not caused by evil, but by simple ignoranceIII. Usage1) lonely 2)friendly 3) weekly, monthly 4)lovely 5) cowardly 6)kindly/ saintly 7) lively 8)motherly Comprehensive ExercisesI. Cloze1. Text-related1)forged 2) stand up 3) compelled 4)convictions 5)mission6)abolish 7) intent on 8) risk 9)in the eyes of 10)threats2. (Theme-related)1) assistance 2) involved 3) estimated 4)coincidence 5)emerged6) referred 7) numerous 8) stationed 9)concern 10)captureII. Translation1.Though greatly affected by the consequences of the global financial crisis, we are still confident that we can face up to the challenge and overcome the crisis.2.Under threat of constant sand storms, we were compelled to leave our cherished village and move to the new settlement.3.According to a recent online survey, a lot of consumers say they may be motivated to consider buying products shown in TV commercials.4. Having spotted a truck driver dumping contaminated waste alongside the river, the old man reported to the police at once.5. Some scientists hold to the firm conviction that people will come to like genetically modified crops someday sincethey can increase yields and help combat hunger and disease in the developing world.Shortly after he achieved freedom Henson became intent on assisting fugitive slaves. He secretly returned to the United States from Canada several times to help others to travel the Underground Railroad to freedom. Once some slave catchers closed in on the escaping slaves and Henson when they were on the run. He disguised them and successfully avoided capture. Later he built a small settlement in Dresden in Canada for escaped slaves, setting up a chapel and a school. He held to the conviction that slavery would be abolished, and the day was bound to come when racial discrimination no longer existed.。
新编大学英语视听说3Unit1听力原文和答案
新编大学英语视听说3Unit1听力原文和答案3Unit1 听新编大学英语视听说力原文和答案Unit 1Part OneListe ning IIn terviewer: An gela, you were born in Korea but you've been living in Canada for a long time, have n't you?An gela: Yes, I was 10 years old whe n my pare nts immigrated to Can ada and「ve bee n livi ng here for 20 years now.In terviewer: Do you thi nk that bel onging to two differe nt cultures has affected your pers on ality? Angela: Yes, definitely. There are times when I think that I have two pers on alities. Depe nding on where I am and who「m with, I'm Korea n or 「m Can adia n.In terviewer: That sounds complicated. Could you expla in what you mean?An gela: Well, grow ing up in Can ada whe n I was going to high school, for example, I was known as An gela to the outside world, and asSun-Ky ung at home. I would wave hello to my teachers, but bow to my pare nts' Korea n frie nds whe n they visited our home.In terviewer: Do differe nt cultures have differe nt ideas as to what is polite?An gela: Yes, defi nitely .In high school, I was expected to look straight in the eyes of my teachers and to talk ope nly with them. But whe n Korea ns spoke to me, I was expected to look at my feet and to be shy and sile nt.In terviewer: Do you thi nk that hav ing two pers on alitiesmakes you a richer pers on?An gela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello4) bow5) look straight in the eyes of 6) ope nly 7) look at my feet8) shy and sile ntListe ning III am a very sen sitive pers on, and that's good to a poin t. I feel every one should be able to feel or un dersta nd what others are going through. But whe n you suffer and cry for people you don't know, or over a movie that s 6nly a story, then I think that's a little too sen sitive. That's the way I am.I am also a very in depe ndent pers on. I must do things by myself. I don't like people doing things for me, or helpi ng me, or givi ng me thin gs. It's not that I don't appreciate it. I just feel that whe n some one does somethi ng for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone any thi ng.I thi nk I would be a good frie nd. I would do almost any thi ng for some one I like; and I would share orgive any thi ng I have. I'm very cari ng and understanding. People trust me with their secrets, and they're right for doing sobecause I n ever tell others any secret that is told to me. 「m always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good.I find fun in almost everyth ing I do (except housework). I like to watch people, talk to them, and be around them. It makes no differe nee whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy lear ning and being aware of everyth ing and every one around me.Exercise 11. sen sitive/ cari ng in depe ndent / un dersta nding2. good friend3. life people4.learning being awareExercise 21. B2. C3. A4. D5. BListe ning IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Ci ndy and I are going ice-skati ng on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for n ext week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cin dy's sister, Kristi. We could double-date. She's really outgo ing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-ce ntered. She could n't stop talk ing about how great she was. I'm not sure if I can trust you, "Mr.Matchmaker".Bill: Oh come on. So I made a mistake last time. Ci ndy's sister is really differe nt.Tom: Well, what does she look like?Bill: Ah. Looks aren't importa nt. She has a won derful pers on ality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter tha n you are.Tom: Go on.Bill: She has a great figure, a nice complexi on, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kiddi ng. By the way, she was the runn er-up in the Miss California BeautyPagea nt two years ago. Well, you're probably not。
视听说3完整版详细答案
视听说3完整版详细答案第一单元12/19 take a break why not some other time party available listen without talk to you about researching background work on hoping for break may be it By the way1A/5 she doesn’t work…… her sch…… she has…… she didnot…… she often1B/5 kind of it’s about right I did past three years paid of earned break the case in comparison to depends on a lot harder in general my roommate way too for myself a balance 2A/5 confident relaxed tense in a bad mood2B/5 1)How about 2)too 3)Why don’t 4)enough 5)Let’s 6)to walk3/5 1)am taking 2)work 3)have 4)am writing5/5 sorry I don’t I’m sorry That’d be ——第二单元3/19 money Goss They this on nick8/19 couldn’t has lost won’t-10/19 Tali Make HeNew story she can’t believe11/19 Nick too Talia doesn’t might not be12/19 get expert run broadcast competition In fact Speaking ought to give away Good thinking handle care audio expert fast on it You do hard to believe wake up smell the coffee crazy famous taking a bribe smart I hope get in the way work on 1A/5 alittle There thought would1B/5 heard about was caught they say what to think stuff you’d like to really convinced actually natural athlete in the season any opinion about disqualify for the sake of shame to in trouble with start rumors 2楼2A/5 连线arise对come up what对what that’s对that2B/5 trus croo bogus authentic3/5 Have have ever ought lately You’d better5/5 Idon’t wow They say Ap hey you You’re第三单元3/19 Nick career star8/19 More not the nike10/19 1\The audio 2\Don’t be 3\最长的 4\to go and talk11/19 hasn’t finish he it nay trick her12/19 Bad news audio expert check urgent be sure absolutely sure have an idea may remember confide in reporter researcher chance lose one more day only one more day won’t be sorry story get tell me everything deserve a break storycharming charm out of1A/5 They didn’t she didn’t she needed pop corn It’s a story1B/5 1)was thinking 2)That would be ok 3)this new mall 4)having a sale 5)kind of 6)a whole lot less 7)just really 8)endup using little 9)Well 10)little girl 11)the whale 12)sounded really good 13)a lot 14)a lot less 15)you know what 16) treat you to2A/5 1)figure it out 2)investigate 3) result 4)make sense 5)ruined2B/5 urg对very to put对risk Sem对one of charm对to persuade3A/5 Talia对is able to she tell对be able to Tony对is not able Talia对is able 3B/5 yours mine5/5 I have an well,Idon’t If you Do you What do it’s worth Let’s go第四单元2/1 9 the asked her :so: he rent her a little N ick8/19 diffcult amusing dis English gland10/19 They could Did He think all To win3楼11/19 doesn’t he can he wants angry12/19 isten your side of the story Nope all alike judgeme trust only goal helping win deal with mess chargesserious threw a game gambling debts gave access to stop from Did you or didn’t you throw the game get show viewers Take your pick innocent1A/5Those Recently Time doesn’t He works He looks really 1B/5 ran into my gosh doing fantastic the same old howexciting perfect for or something like thata boring job gets to telemarketing telephone company2A/5 allow plan jour a part2B/5 Take a pick /T ake it easy/Take your time /Take a look3A/5 aa the a3B/5 aren’t /will you/does she/could he/hasn’t he/doesn’t she/didn’t I/wasn’t he5/5 I think I know you How have you been No,I’m sorry I’m afraid you’ve got It was great Here’s my card 单元测试1/3How did对He no longer when对when2/3 Nick对Which story Nick对the same3/3 The announce ……plays The announce talks about poetry……identifics1/3 in a bad mood /exhausted2/3 trustworthy/dishonest3/3 disgraceful action relax not guilty be……sense of planto don’t hurry1/3 are am Let’s go too much Why don’t I4楼2/3 received am going to ever should ’d better3/3 aren’t you an was the have seen good my am ableto dfferent haven’t2/5 serious talk busy3/5 different same different5/5 rising risingSPEAKING1/3I’m sorry it sounds I just don’t that would be That sound really good 3/3If you Iwill spend That’s Ijust Let’s 第五单元3/19 It’s im He was Shy8/19 very she plays he anything she wants Nick to know unbelievable 10/19 He’s not He Nick He’s getting11/19 I’would Talia shocked annoyed12/19sure sounds like stupid a minute deliberately from college works for recognize teammate bothexcuse us media you’ve got that right get it worry you getting some pressure sit out badlyfrankly win without you1A/5 call Her she couldn’t 100 A little1B/5 the whole story on the phone this rebate A hundred dollars supposed to of the camera nice aboutit serial number is gone Oh man 8002A/5become excit succ…… like begin2B/5 1)do you feel 2)do you think 3)are loving 4)such 5)so 6)believe2009-11-21 10:125楼3/5 so /such a /so /such /so /such a5/5 1)can I ask you to take a2)I have to take care of3)I’m tied uo at the moment4)Would you mind if5)Can you please check6)OK,no problem7)please fill this form第六单元3/19 She was No the result Talia8/19 1\Nick put50000 into hisbank account 2\she believes 3\he owes 4\making money 5\people 6\Ibel that 7\can’t 9/16 keep investigating have no choice going with beat us to it You’ve got to admit missing something asthey seem in this case too trusting skeptical all right working on fair let my emotions color myjudgment let me down won’t be sorry10/19 speptical He believes should work The bank11/19 they have to some want Dony1A/5 are allow Wise stop ID Dany1B/5 says at bars to have their parents thirteen years old get drunk you know drinking irresponsiblytheir kids baby-sitter bar owners this is happening crazy2A/5 Take对we have we don’t 对we decide For对For one we never对we are 2B/5 1)deposited 2)bank account 3)As a matter of fact 4)Take it from me 5)For one thing 6)except for 7)go with 8)beat us to it 9)let us down6楼3A/5 going/talking/eating/yourselves/myself/had known/would have brought/crying over /enjoying3B/5 1)may 2)may not 3)Is he 4)will 5)might not 6)may 7)aregoing to 8)might5/5 Do you think might perhaps It’s didn’t Is it possible that Nick didn’t take the money might第七单元3/19He explained 最长的 annoyed8/19 It’s brand He agreed Because+最长的By cheatingg Because he wants to amuse Talia Because angry she was angry Nick had not told here the truth10/19 He wasn’t going to tell A business woman TO visit To wear11/19 He was curius He will wear it would She want to ……truth12/19 here it comes juice bar Aren’t you Do I know you Not yet interesting proposition Keep goingLet’s say deal endorse athletic That’s it business card on second thought pay visit1A/5 They party+最长的 Thefirst job in it she wanted shemight Thefirst could go to earlier1B/5 great opportunity audition for such a wonderful show the same night other plays coming along so perfect so great about be invited go for it2A/5 They paid me so that Ichanged I want to know The shoes will becone Ok It doesn’t come and experience 2B/5 confirmed lines cone out basically endorsed3A/5 1)was taking 2)called 3)checked 4)was playing 5)quicker 6)more concentrated3B/5 would rather prefer to would prefer to2009-11-21 10:127楼5/5 soundslike fun or really? oh,really? Isee How awful How did it go Did you have a good?第八单元3/19she was trying Talia there was8/19 he meant to make meet jack hci had never jackie has neverworked Talia might G ower Buil ding Frustra show forten years10/19 Because she thought Nick had lied to her Neither she was very she used the recoptionst’s11/19 he enjoy finding show her anger she thinks confsed 12/19 dead for a moment angry yell at Maybe Probably guest dial in big trouble have trouble with used to memory to makematters worse ridiculous took lunch voice mail available odd telling thetruth lying see a good story1A/5 she asked for Try to she could meeting 4321B/5 looking for I mean quite a while at the desk Whatever Kind of hard for her name impossible totally screwed up pretty clear meet me lobby 4 o’clock good idea try where she is why don’t you how that goes2A/5 please wait sorry+短的 If you+长的Nick ……punished Tia+长的 The right now2B/5 odd Anyway In that case yell at ridiculous3A/5 where I can When the how much it what kind of used to3B/5 someone / used to /didn’t use to /something /anything /单元测试2LISTENING1/3Talia tells Nick that she believes him: {1.Nick meets Jackie baker8楼 2.Nick explains the deal he made to Talia.3.Talia decided to do see Jackie.2/3 1.The receptionist gives the office location.2.The receptionist gives the directions to the office.3.The receptionist asks for a signature3/3He had a health accepting He accepesVOCABULARY1/4get along get going2/4criticizing pressure3/4mutter feelforsomeone. fellfunn whisper4/4 skeptical asking tostep acknowledged down madeup approachable Let them off transfGRAMMER*/2 (Amy:Hi,Ronnie) 22111即 better were having more intelligent was listening would rather*/2 (Dear Mom) 12122即used to be somebody who that person is anybody where she lives PRONUNCIATION1/4cann’t can used2/4he /E/ her4/4 she up at 长的1/4 sorry to how was it?3/4 I really double it It’spossdidn’t I’m tired up oh,really? Ihave to take care of Did he have4/4 oh,really? How was That’s great第九单元3/19 5点 looking for There8/19 Because he needed the recept he was still Because hewondeved He wasn’t very He over To find 6点9楼10/19 Because he was trying Tell the she has blue he just 11/19 I’m confused help she never12/19 anything else someone else either In fact cheer up as bad as describe business suit excutive at all1A/5 she can bring cook for Go to Aby’s Emily’s1B/5 favor wondering bring two of my friends definitely supposed to messed up have a great time decorations last minutecooking things great to serve 6:30 three of you2A/5 the news+短的 Are you interest Hey, can may you +长的 I hend by she +短的2B/5business overheard follow describ cheer up3A/5 1)rushed 2)was checking 3)was playing went3B/5may as honest as as positive as can could as disgusting as5/5 sorry,but No,pr…… sure can I leave ma y be I can is it ok Do you第十单元3/1 9 The woman The inter……did not answer An……Dear8/19 he got into he made an he could not Things wer badly hewanted the woman the soccer the intertiew10/19 Dean’s They wear both she felt sorry she took10楼11/19 he wespec ts she has sarc…… sorry12/19around lately ran into admired ruining his career prettysure different changing the color wannabe tried outExcept for took lunch performance beginning to unfoldOn the house in his favor soccer professionally1A/5 do a survey noise is a the univer+长的 housing therre should1B/5 on behalf of a couple of minutes greatly appreciated more time building classrooms dorm roomsobviously point better quality more people at least pretty nice spacious rental houses stay in mixedfeelings involved in helps them out definitely issue2A/5will be get up stop to his unexp be made2B/5 uspended preformance catch up on on the house trying out3A/5 on with/out /up3B/5 losing /saying/ to need/ to wait3C/5 until/when/have5/5 Actually T o tell you what do you I’m not really 同上 If you ask Frankly第十一单元3/19 she think To tell How good8/19 he understand she joked……reporter upset she knowNick Nick she talks……party10/19 It’s nicer he’s going……happened no kick+长的11楼11/19she is angry she doesn’t Dean sorry,Nick12/19 won’t be sorry admit lied There you are are got reservations just around the corner doing business so much pleasant talkoverover lunch sign basically says endorse the shoes tricked out of the way next in line star player amazing team office make sure1A/5 Sunday write Next w…… 4:30 M……1B/5 are responsible for Africa visual aid in the outline easy look that up really quick have it all done due Wednesday needto meet I’m supposed to do compile get our project done off the Internet helpful use bring those in tomorrow2A/5They+短的 jose+短的 jack+长的 we+短的jane’s+短的2B/5 persuasive tricked persuade raise broke over out of this word3/5 went to see In orderto don’t have to help can’t to talk 5/5 I’ve got to is there anything Nothing I really need to Do you That’ll be第12单元3/19 To keep By working Nicknever had8/19 Nick is more To tell him he is That having money problem they have been hard to the so长的10/19 Surprisees长的He want’s ......truth To prove He didn’t (i)2009-11-21 10:1212楼11/19he is N ick’s tell Nick 长的 almost uncertain12/19buddy Tough rap really happened scheme talented plotting for dreamed up fake planning impressedtalking crazy expect figure out made up craziest stories pulledoff typical so sure of popular prove———-1A/5 she could she turned长的 A map of Africa Tuesday3小时 Teacher1B/5 the habitat of the animalsblue folder rest of the projectmap definitely different spotturned it in reliable sourcecoming to me instead of positively check with2/5 handed it in figured let you turn it3A/5 how long for since has been playing3B/5 figure them out help you out put them away clean it up the most expensive the best5/5 I’m not quite sure what you’re getting at. /Exactly./Do you mean that/NO,that’s not what I mean./ Could you go over it again? / Are you saying that测试LISTENING1/4 howdoes对He listened he wants to2/4 says he hasn’t heard of Kicks shoesto help Nickeye color3/4 Spread on the mustard:1.Put on the cheese and avocado.13楼 2. Put on the tomato and cucumber3.Add the secret ingredient.4/4 Gomez对if her team The team appearingVOCABULARY—————1/4 Marcello:Hi,Amy: pulled it off pass on2/4 Talia:Hi,Mom: Keep cool play it by ear3/4 come up with break down4/4 out of control out of this worldGRAMMER—————1/4 the luckiest pick him up best for dream this up2/4 Tony:So,Talia: think of working could start was doing as difficult as 3/4 Secretary: may to talk as easy as will give 4/4 interesting to buy surprised to invite havePRONUNCIATION1/5 up out2/5 I want to get and it3/5 single sound spr…… gl……4/5suprised going5/5 I have to has is —————SPEAKING1/3 Yes,what do you neeed I really need to2/3 Are you saping it Yes, that’s whatI mean3/3 Are you saying it didn’t go well Yes,that’s what Imean 过级最终测试Level Test—————listening1/5talia thinks…eliminated—the soccer teamthere is a rumor—has an injurytony thinks nick—a good soccer2/5what does the coach say the socer—they want nick not to palywhat does the coach ask to be—he doesn`t trustwhat dose nick say the tv station—he planned ahead3/5nick says his life is—a messnick says he needs—the newsdean doesn`t want to—comment about nicknick agreed to endorse—shoes4/5OK, I’m wondering…:couple sit-down silverware accommodateeasy-going understanding favor attractive settingsshe knows it’s kind of out of your way for us to go to this party Pick(注意大写) up anything else get somesome wine or dessert or bring anything5/5Alex.My old boyfriend Alex.:I looked really good toolook your bestNo way doing things and moving onhang out or somethingvocabulary1/6talia:i`mtry,but—truthamy:what`swrong,talia?—exhautedamy:you need to rest more—easy2/6which phrase means to want to do something?—feel like doing someting Which phrase means to understand something?—get itwhich word describes a loud way of speaking?—roar3/6dean:well i can tell you—reactionshoutthrough it4/6patty:he`s innocent—out of the waytalia:i know—dream uppatty:i can`t believe—wait and see5/6two boys were caught smoking—let them offexcuse us for a minute—asking to step asidethe government is tring to—downwe…for lost time by—made up6/6figure out—be able to come up withtake your time—don`t hurrythrow a game—plan to lose a sports gamegrammar1/4Tony:I(选词) : want am having would rather anyone better nick:i don`t know what to do—through itdean:i can`t believe all of—shout2/4dean:itink nick should—couldcoach:at first—was hoping3/4patty:well,i could add—hold on secondnick:thanks,i appreciate—best4/4talia:i…to see nick—havedean:why do you need to see him?—to talkdean:i think he`s too busy—concernedpronunciation1/6falling rising falling2/6forget debts talk3/6men{tion} ab{so}lutely4/6He…stuty—used to can’t5/6(br)eak (str)eet6/6looked—single sound talented—extra syllablespeaking1/2mark:what do you think about—frankly2/2but i`ve got one favor to ask you—ok.no problemhe was accused of taking drugs—yeah.absolutelyyou won`t believe who i ran into today—whoif you go shopping with me—that sounds goodyou studied so hard on the test—no.i didn`t prepare for it at all。
新编大学英语视听说教程3(十单元)听力标准答案
Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being aware Exercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) English1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beard1. B2. C3. D4. AExercise 21.4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species5) oxygen 6) economic 7) conservation 8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America, pet food, enough protein, develop2. much more, Asia ,Africa3. position, natural resources, gone down, steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease7. education services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ¥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and pre judices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy with Section II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Exercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particular Exercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train 13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.T1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking8. convenient9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. T1. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A5,7,1,4,6,3,2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13.careers 14. interestsListening II Exercise 11. B2. D3. A4. D1. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.W1. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic 11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slower Exercise 21. T2. F3. F4. T5.T6.F7. T8. F Listening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel:musicalBranford Marsalis: brilliant, humorousYoussou N’Dour:not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. T Exercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying 10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 11. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 11. T2. T3. F4. F5.F6.T7.F8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days8. give up9. stop trying 10. encounter risks 11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious 16. angel 17. grave 18. nights 19. days 20. taste。
新编大学英语视听说教程第三册答案.doc
Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5.travel around in 6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice Two(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。
新编大学英语视听说教程第三册答案
Keys to the texts of book3Unit OnePart OneExercise 2 :1.Mike C2.Sam E3..Ted D4.SimonA 5.Lilly BExercise 31.avoid; power2.social; outgoing3.reputation;4.despite; wittiest5. make up for; protective6.describe7.perfectionist; critical8.matches9.traits; improved 10.get rid of; characteristicsPart TwoListening IExercise 11 F 2.F 3.T 4.F 5.T 6.TExercise 21.outside world2.at home3.wave hello4.bow5.look straight in the eye6.openly7.look at my feet 8.shy and silentListening IIExercise 11.sensitive; caring2.good friend3.life; people4.leaving ; being awareExercise 21.b2. c3.a4.d5.bPart ThreePractice oneExercise 11.ice-skating2.chemistry3.outgoing;bright; funny4.moody; self-centered5.wavy blond; medium size6.runner-upExercise 21 T 2.F 3.T 4.F 5.F 6.TPractice TwoExercise 11.42.collogues3.teacher4.Susan5.Barbara Exercise 21.DEJ2.BF 3CH 4.AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energeticler patient3.Mr.Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2.T 3.F 4.F 5.TExercise 2flattering 2.critical 3.popular 4.reserved 5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2.sensible3.lecture4.calm5.strengthnded7.waving 8.perfectly 9.wildly 10.beeSection II My history teacher1.b2. b3. d4. b5.d6. a7. c8. bSection III What do you think of yourself?1.secretary2.hardworking3.efficient4. private5.army officer6.help7.fond8.independent9.shy 10.fifteenUnit TwoPart OneExercise 2 :1. C2. E3.D4.B5.AExercise 31.in your hand; used to belong2.practicing with3.talk to each other; why not4.ask for; find a way5. manage to; his own love6.so foolishly jealous7.all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4.B 5.CExercise 21 T 2.F 3.T 4.T 5.F 6.TListening IIExercise 11.a2. a3.b4.c5.cExercise 21.T2.F3.T4.T5.F6.FListening IIIExercise 11.stayed around2.mouse catcher3.rats and mice4.got a paw5. weak and thin6.make a wooden paw7.fastened it8.grow sleek and fat9.managed10.peered out cautiously11.seized it with 12.eighteen micePart ThreePractice oneExercise 11.b2.a3.a4.c5.d Exercise 21 F 2.T 3.T 4.F 5.T 6.F 7.F 8.T Practice TwoExercise 11.C DJ2.AEGH 3BFI Exercise 21.a2.b3.d4.c5.b6.d Practice ThreeExercise 11.b2.d3.c4.d5.aExercise 21 F 2.T 3.F 4.F 5.F 6.TPractice FourExercise11.b2. c3. b4. a5.d6. a Exercise 21 F 2.F 3.T4.T 5.FPart Four Testing yourselfSection I Little Red Riding Hood1.c2. b3. c4. b5.a6. cSection II Spider, Hare and moon1 T 2.F 3.F 4.F 5.T.6.F 7.T 8.TSection III The legend of the cowboy1.18672.shippedlionairend5.cattlelion7.cowboys8.camera9.hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2.C3.B4.E5.AExercise 31.T2.F3.T4.T5.T6.T7.F8.F9.T10.FPart TwoListening IExercise 11.b2.C3.d4.aExercise 21 F 2.T 3.F 4.T 5.F 6.TListening IIExercise 11.b2.d3.a4.dExercise 21.30’s2.male3.1.904.long ; wavy5.heavily built6.light red sweater7.beardListening IIIExercise 11.b2.C3.d4.aExercise 2(1.4.5.7).yesPart ThreePractice oneExercise 11.natural riches2.desert3.extinction4.species5.oxygen6.econimic development7.conservation8.valuable income9.awareness 10.slow downExercise 21 T 2.F 3.F 4.TPractice TwoExercise 11.F2.F3.T4.TExercise 21.south America; pet food; enough protein; develop2.much more; Asia; Africa3.position; natural resources; gone down; steady4.continue to rise5.getting richer and richer Practice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5.looked directly at6.All around7.until now8.despair grief and disgust9.started crying 10.who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4.house5.school6.friends7.father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3.got out of4.on the ground5.shocked6.cold-blooded killing7.investigation 8.drug dealing mon 10.against 11.strong views ing drugs 13.too early14.respectable 15 accused ofSection II1.c2. b3. a4. b5.cSection III1.over-crowded cities2.poverty disease3.the drift4.registration5.resentment6.attractivecation services 8.rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3.internship4.lecture; competitionputer programming skills6.impatient7.constructive8.medical research9.management 10. 3,600Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21.weaknesses2.similar abilities and interests; interest us; important and challengingcation ;.promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5.getting money; our future happiness; combinationListening IIExercise 11.choose their careers2.avoid certain careers3.different professions4.children’s impressions and prejudiceswyers6.accountants7.scientists8.most popular9.least popular 10.ignorance1.T2.T3.F4.T5.F6.TPart ThreePractice oneExercise 11 d 2.d 3.a4.bExercise 21.sales manager2.salary3.sales commission4.a car5.travel around in6.experiences7.university 8.on a teamPractice TwoExercise 11.b2.b3.a4. c5.cExercise 21.65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign languagePractice ThreeExercise 11.c2.a3.b4.d5.bExercise 21.ADF2.BF3.ACEPractice FourExercise1sensitive; extroverted 2.kids 3.doing a good job 4.tolerancelevel 5.patientExercise 21 T 2.F 3T 4.F 5.TPart Four Testing yourselfSection I1.100 million2.35 to 403.7 to 84.office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8.choose their own working hours; freedom of choice; happy withSection II1.d2. a3. a4. c5.dSection III1.b2.c3.c4.d5.aKeys to the texts of book3Unit FivePart OneExercise 2 :1.B2.A3.C4.E5.D6.FExercise 31.over long distances2.look into it3.five times4.individual; group5. sex-specific;; males; females; strangers6.great apes7.teach ; own kind8.raised ; held; look bigger9.round ; tail-wagging10.feeding; every directionPart TwoListening IExercise 11.plays; real people; real life; emotional problem; loyalty2.public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2.F 3.T 4.T 5.T 6.TListening IIExercise 11.c2. a3.dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5.anxiety; effectPart ThreePractice oneExercise 11.d2.a3.b4.a5.bExercise 21 permission ;apply for 2.application form; web site 3.regular mail; fax 4.traveler’s checks; credit cards Practice TwoExercise 1(2.3.5) yesExercise 21.T2.F3.F4.T5.T.6.TExercise 31.other native languages2.two3.more4.of their choice5.Spanish6.Indian’s Spanish7.English;8.German 9.FrenchPractice ThreeExercise 11.learner; teacher; curriculum2.aptitude; expectations; goalsExercise 21.T2.F3.T4.F5.T.Practice FourExercise11 c 2.c 3.a 4.bExercise 21.eggs and toast2.realistic; goals; far better than; forgetting3.determined; personality .culture4.unusual ; recite aloud Part Four Testing yourselfSection I1.religions2.exist3.40,0004.cave5.moon6.birth7.records8.agree9.by 10.sense 11.ourselves 12.inhabit Section II1.F2.T3.F .4.T5.F6.T7.T8.TSection III1.a2.d3.c4.d5.b6.a。
新编大学英语视听说3纯答案版
新编大学英语视听说3纯答案版Unit 3Part OneExe 2 D C B E AExe 3 T F T T T T F F T FPart TwoListening IExe 1 BCDA Exe 2 FTFTFTListening IIExe 1 BDADExe 2 30s, male, 1.90, long wavy, heavy built, light red sweater, beardListening IIIExe 1 BCDA Exe 2 1, 4, 5, 7Part ThreePractice OneExe 1 1) natural riches, 2) desert, 3) extinction, 4) species, 5) oxygen, 6) economic development, 7) conservation, 8) valuable income, 9) awareness, 10) slow downExe 2 TFFTPractice TwoExe 1 FFTTExe 2 1) South America, pet food, enough protein, develop2) much more, Asia, Africa3) position, natural resources, gone down, steady4) continued to rise5) getting richer and richerPractice ThreeExe 1 1) the few seconds, 2) so thin, 3) beings from anotherplanet, 4) focused on, 5) looked directly at, 6) All around, 7) until now, 8) despair grief and disgust, 9) started crying, 10) who was sleeping peacefullyExe 2 1,2,3,5,8Practice FourExe 1 BCACExe 2 love, together, mother, house, school, friends, father, month, beach, callPart FourSection I complained about, work, got out of, on the ground, shocked, cold-blooded killing, investigation, drug dealing, concern, against, strong views, using drugs, too early, respectable, accused ofSection II CBABCSection III 1) overcrowded cities, 2) poverty, disease, 3) the drift, 4) registration, 5) resentment, 6) attractive, 7) education services, 8) rural lifeUnit 4Part OneExe 2 1) computer programmer, 2) computer engineering, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical, 9) management, 10) 3600Exe 3 1,2,4,6,8,9,11,12Part TwoListening IExe 1 2,3,4,5,7Exe 2 1)weaknesses, 2) similar abilities and interest, interest us, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combination Listening IIExe 11)Choose their careers, 2) avoid certain careers3) different professions, 4) children’s impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignoranceExe 2 TTFTFTPart ThreePractice OneExe 1 DDABExe 2 sales manager, salary, sales commission, a car, travel round in, experience, university, on a team Practice Two Exe 1 BBACCExe 2 1) 65 words, 2)90 to 100 words, 3) with languages, translate letters, answer the phone, foreign visitors, second foreign languagePractice ThreeExe 1 CABDBExe 2 1) ADF 2) BF 3) ACEPractice FourExe 1 1) sensitive extroverted, 2) kids, 3) doing a good job, 4) tolerance level, 5) patientExe 2 TFTFTPart FourSection I1.100 million2.35 to 403.7 to 84.Office workers, many professionals5.8:00 to 4:006.eight-hour shifts7.Monday, Thursday, Saturday, Sundays8.choose their own working hours, freedom of choice, happy withSection II DAACDSection III BCCDAUnit 5Part OneExe 2 BACEDFExe 31.over long distances2.look into it3.five times4.individual, group5.sex-specific, males, females, strangers6.great apes7.teach, own kind8.raised, held, look bigger9.round, tail-wagging10.feeding, every directionPart TwoListening IExe 11.plays, real people, real life, emotional problem, loyalty, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kindExe 2 FFTTTTListening IIExe 1 CADExe 21.be understood easily2.necessary, desirable3.splendid4.prevents, from achieving5.anxiety, effectPart ThreePractice OneExe 1 DABABExe 21.permission, apply for2.application form, Web site3.regular mail, fax4.traveler’s checks, credit cardsPractice TwoExe 1 2,3,5Exe 2 TFFTTTExe 3 1) other native languages, 2) two, 3) more, 4) of their choice, 5) Spanish, 6) Indians Spanish, 7) English, 8) German, 9) FrenchPractice ThreeExe11.learner, teacher, curriculum2.aptitude, expectations, goalsexe 2 TFTFTPractice FourExe 1 CCABExe 21.Eggs, Toast2.realistic, goals, far better than, forgetting3.determined, personality, culture,4.unusual, recite aloudPart FourSection Ireligions, exist, 40000, cave, moon, birth, records, agree, by, sense, ourselves, inhabitSection II FTFTFTTTSection III ADCDBAUnit 7Part OneExe 2 CBCDAExe 31.fun holiday2.natural scenery, historical interest3.summer, too cold4.long history, vast territory5.feed the monkeys6.as many places as possible7.you name it8.host city, ancient civilization, modern architecture9.city wall, treat yourselves10.express trainsPart TwoListening IExe 1 CBBCDAExe 2 SN 862 SN 86317:50, July 11 15:10, July 14 Listening IIExe 1 BCFGHIExe 21.FTTT2.FFTF3.TTTTFPart ThreePractice OneExe 1 ADHEExe 2 CDBCPractice TwoExe 1 seedy, company, shared, noisy, early, private, booking, convenient, restaurants, bathroomsExe 2 TFTTFTPractice ThreeExe11.Fuel2.Water3.Vehicles4.clothesExe 21.passing lorries2.enough water3.drinking4.vehicle5.emergency6.self-sufficient7.car repairs8.cost much, be costly9.sweaters10.European winterPractice FourExe 1 Occupations: B AHoliday: ABBABAABExe 2 TFFFFTFTPart FourSection I FTTTFSection II BCCCADSection III DBCDAUnit 9Part OneExe 2 CCCWWCCCCWWWCWWCWW Exe 31.prefer, old-fashioned2.as old as,3.account for4.own, play, earn a living5.very proud of6.1.5 billion, had the chance7.hills, small bridges, singing of birds8.full of energy9.holes, buttons, precise notes10.indirectly, individualistic11.places great importance on12. a universal languagePart TwoListening IExe 11.restaurants, airports, supermarkets, banks2.a. attitudes, in the right moodb. a better feeling, the people around himc. happy, work better3.a. World War II, happy, calmb. a machine, kind of music, different times, faster, slowerExe 2 TFFTTFTFListening IIExe 11.eases their minds, operations2.classical, instrumental jazz, folk music3. A. reduce tensionB. 50 male doctorsC. MathematicsD. quickly, calmly, chosen for them, No music, the worstE. sleepyExe 2 TFTFFPart ThreePractice OneExe 1 BDACExe 21.their own style2.the nature3.sounds, experimented4.songs, records5.films, awardsPractice TwoExe 1 1. 1) trumpet 2) piano 3) violin2. 2) piano 1) clarinetExe 2 picks the strings, as hard as, make the notes, on the strings, manages the bowExe 3 1) learn, 2) carry, 3) popular, 4) satisfying, 5) progress, 6) easiest, 7) less satisfying, 8) most difficult Practice ThreeExe1 TTTFFFFTExe 2 4, 1, 1, 1, 3, 2, 5, 4, 5, 1, 5, 5Practice FourExe 1 ABACAExe 2 TNTFTPart FourSection I TFFTFTTTSection II 2,4,7,8,10,12Section III falling, nice, cold, inside, raining, tears, happen, arms, fire, gone。
新编大学英语视听说教程三册答案
Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. Barbara Exercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combination Listening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5. travel around in6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign languagePractice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerancelevel 5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; lookbigger 9. round ; tail-wagging10.feeding; every directionPart TwoListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regularmail; fax 4.traveler’s checks; credit cardsPractice TwoExercise 1(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7. records8. agree9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. aTHANKS !!!致力为企业和个人提供合同协议,策划案计划书,学习课件等等打造全网一站式需求欢迎您的下载,资料仅供参考。
新标准大学英语视听说教程3答案
Unit 1 Outside view: Activity 3Row 1: 2 Row 2: 1 Row 3: 4 Row 4: 1 Row 5: 2 Row 6: 1 Row 7: 3Unit 1 Listening in: Passage 1 Activity 1Question 1 Key: c Question 2 Key: d Question 3 Key: aQuestion 4 Key: bUnit 1 Listening in: Passage 2 Activity 2Question 1 Key(s):(1) strengths (2) weaknesses (3) personality (4) like(5) subjects (6) organized (7) confident (8) outgoing (9) a team(10) working alone Question 2 Key(s):(1) future careers(2) into a particular area of work (3) chosen field(4) related industries (5) leadingQuestion 3 Key(s):(1) vocational (2) graduates (3) high-flyers (4) career (5) practical (6) transferable (7) recruitmentUnit 2 Outside view: Activity 2(1) where there is war(2) go to school(3) working in 157 countries/working in one hundred and fifty-seven countries(4) has never known peace(5) bringing medicine(6) get an education(7) 40,000 kids/forty thousand kids(8) girls were not allowed(9) 50 per cent/50 percent/fifty per cent/fifty percent(10) running the school for 12 years/running the school for twelve yearsUnit 2 Listening in: Passage 2 Activity 1 Correct order: 3, 6, 1, 4, 2, 5Unit 3 Outside view: Activity 2(1) most famous painting(2) broke all the rules(3) looking directly at(4) a sense of movement(5) indicated a real place(6) what is she trying to say(7) covered up one side of her face(8) we're the subject(9) seemed happier(10) the mystery about her(11) line up between(12) tell a storyUnit 3 Outside view: Activity 3Row 1: 2Row 2: 1Row 3: 1Row 4: 1Row 5: 2Row 6: 1Row 7: 1Row 8: 2Row 9: 1Row 10: 2Row 11: 1Row 12: 2Unit 3 Outside view: Activity 4Correct order: e, a, d, b, c, g, f, hUnit 4 Listening in: Passage 1 Activity 2Unit 5 Outside view: Activity 4 Correct order: 2, 10, 13, 3, 7, 8, 1, 9, 11, 14, 5, 6, 12, 4Unit 6 Outside view: Activity 2Unit 6 Listening in: Passage 2 Activity 1Question 1Key(s): zookeeperQuestion 2Key(s): Al GoreQuestion 3Key(s):making people take climate change seriouslyQuestion 4 Key(s): Greenpeace Question 5 Key(s): mum, part-time accountant Question 6 Key(s):Melinda GatesQuestion 7 Key(s):co-founding the Bill and Melinda GatesFoundationQuestion 8Key(s):Save the ChildrenUnit 9 Outside view: Activity 2Unit 9 Listening in: Passage 1 Activity 3Question 1 Key(s):(1) attractive, powerful(2) attractive, powerfulQuestion 2 Key(s): to think of Question 3Key(s): much too long Question 4 Key(s): meaning very small Question 5Key(s): the best or the strongest Question 6 Key(s): most romantic lovers Question 7Key(s): sound luxurious。
新编大学英语视听说3Unit1听力原文和答案
3Unit1 听新编大学英语视听说力原文和答案Unit 1Part OneListe ning IIn terviewer: An gela, you were born in Korea but you've been living in Canada for a long time, have n't you?An gela: Yes, I was 10 years old whe n my pare nts immigrated to Can ada and「ve bee n livi ng here for 20 years now.In terviewer: Do you thi nk that bel onging to two differe nt cultures has affected your pers on ality? Angela: Yes, definitely. There are times when I think that I have two pers on alities. Depe nding on where I am and who「m with, I'm Korea n or 「m Can adia n.In terviewer: That sounds complicated. Could you expla in what you mean?An gela: Well, grow ing up in Can ada whe n I was going to high school, for example, I was known as An gela to the outside world, and asSun-Ky ung at home. I would wave hello to my teachers, but bow to my pare nts' Korea n frie nds whe n they visited our home.In terviewer: Do differe nt cultures have differe nt ideas as to what is polite?An gela: Yes, defi nitely .In high school, I was expected to look straight in the eyes of my teachers and to talk ope nly with them. But whe n Korea ns spoke to me, I was expected to look at my feet and to be shy and sile nt.In terviewer: Do you thi nk that hav ing two pers on alities makes you a richer pers on?An gela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello4) bow5) look straight in the eyes of 6) ope nly 7) look at my feet8) shy and sile ntListe ning III am a very sen sitive pers on, and that's good to a poin t. I feel every one should be able to feel or un dersta nd what others are going through. But whe n you suffer and cry for people you don't know, or over a movie that s 6nly a story, then I think that's a little too sen sitive. That's the way I am.I am also a very in depe ndent pers on. I must do things by myself. I don't like people doing things for me, or helpi ng me, or givi ng me thin gs. It's not that I don't appreciate it. I just feel that whe n some one does somethi ng for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone any thi ng.I thi nk I would be a good frie nd. I would do almost any thi ng for some one I like; and I would share orgive any thi ng I have. I'm very cari ng and understanding. People trust me with their secrets, and they're right for doing so because I n ever tell others any secret that is told to me. 「m always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good.I find fun in almost everyth ing I do (except housework). I like to watch people, talk to them, and be around them. It makes no differe nee whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy lear ning and being aware of everyth ing and every one around me.Exercise 11. sen sitive/ cari ng in depe ndent / un dersta nding2. good friend3. life people4.learning being awareExercise 21. B2. C3. A4. D5. BListe ning IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Ci ndy and I are going ice-skati ng on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for n ext week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cin dy's sister, Kristi. We could double-date. She's really outgo ing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-ce ntered. She could n't stop talk ing about how great she was. I'm not sure if I can trust you, "Mr.Matchmaker".Bill: Oh come on. So I made a mistake last time. Ci ndy's sister is really differe nt.Tom: Well, what does she look like?Bill: Ah. Looks aren't importa nt. She has a won derful pers on ality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter tha n you are.Tom: Go on.Bill: She has a great figure, a nice complexi on, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kiddi ng. By the way, she was the runn er-up in the Miss California BeautyPagea nt two years ago. Well, you're probably notin terested.Tom: No, wait!Bill: Ah, just forget I ever men ti oned it.Tom: No, I'm in terested!Exercise 11. ice-skating2. chemistry3. outgoingbright funny 4. self-ce ntered5. blond medium height6. runn er-upExercise 21. T2. F3. T4. F5. FListe ning IVDavid: Barbara, before you go, could you tell me about these stude nts that are com ing into my class?Barbara: Oh, yes. Now, let me think, well,there's…er…Paul. He's a tall, slim lad with fair hair. Very frie ndly face, lovely smile... He's particularly good with group activities, and he's a very helpfulpers on to have in the class and very helpful with the other students. He speaks flue ntly, but does make a lot of mistakes! He does n't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susa n...Susa n. Now, she's very lively, quick, and very bright. She talks all the time but not always in En glish.David: What? Is she difficult or an ythi ng? Barbara: No…she's quite young but she does behave in quite a grow n-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very ni ce. She has dark hair and dark eyes.David: Right, well…are there any other girls in the class?Barbara: Y es, there is Maria. She's Susa n's sister.David: Y es.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has Ion ger hair tha n Susan. She's not quite as bright as her sister and I thi nk that makes her feel a bit in ferior really. Well, you know, she sulks a bit whe n she gets things wrong or she misun dersta nds you. But on the whole, a very sen sible girl.David: OK.Barbara: And the n there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brow n hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determ ined to lear n as much as possible. He asks quite difficult questi ons but he does n't mean to be n asty.David: Well, tha nks, Barbara. It's all up to me now, is n't it? Have a good holiday, won't you?Barbara: Tha nks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susa n5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter AG IFurther Liste ningListe ning IOne day, whe n Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sen sible tha n his wife, so he started to give her a lecture on the importa nee of always remai ning calm.Fi nally he said, "It's a waste of your stre ngth to get excited about small thin gs. Train yourself to bepatie nt, like me. Now, look at the fly that has just Ian ded on my no se. Am I gett ing excited or anno yed? Am I sweari ng or wavi ng my arms around? No. I'm no t. I'm perfectly calm."Just as he had said this, Mr. Smith started shouti ng. He jumped up and bega n to wave his arms around wildly and swear terribly. He could n't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sen sible 3) lecture 4) calm 5)stre ngth6) Ianded 7) swearing 8) perfectly 9) wildly 10) beeListe ning IITom: Oh, that Mr. Taylor. He is so bori ng! Mother: What do you mean?Tom: His less ons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darli ng?Tom: Yes, he gets angry very quickly.Mother: That does n't sound like Mr. Taylor at all!Tom: And do you know, he spe nds all the time look ing at his reflecti on in the win dow, admiri ng himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And con ceited! He thinks he knows everythi ng.Mother: Oh, Tom. Be reas on able. I'm sure you're exaggerati ng. Mr. Taylor seems such a ni ce, kind man.Tom: Well, he isn't. He is mea n and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I un dersta nd. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7.D 8. CListe ning III1. Pedro sleeps only six hours a ni ght. He goes to school full-time and works part-time in theafter noons. At ni ght he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of pers on is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The stude nts did n't un dersta nd. He had to repeat his less on and expla in the idea more slowly. Over the next few days heexpla ined and expla ined the less on un til almost the whole class un derstood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street n eighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom.Each one saw the chair he wan ted to sit on. Unfortun ately, it was the same chair. They both sat dow n at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, the n you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of pers on is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She faste ned a basketball hoop over the wastebasket. Now the stude nts love to practice throwing their paper into the basket. When they miss, they pick the paper up and try aga in. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. MillerD patie nt3. Mr. Smith E ho nest4. Jake A stubbor n5. Mrs. Duke F creative Exercise 21. favorite way to relax2. how to divide3. bad un ripe4. stiff sore5. faste ning a basketball hoop Liste ning IVA nu mber of visitors to the UK, who had traveled throughout the British Isles, were asked by a n ewspaper reporter what their impressi ons of the British people were. Here's a brief summary of what they thought.There were many differe nt opinions among those in terviewed: Some were very flatteri ng, others very critical. The distinction between the En glish and the British was n't always un derstood, but, onthe whole, it seemed that the Scots were very popular with visitors. They were thought to be very frie ndly, eve n though one Dutch visitor con fessed she'd found it hard to un dersta nd their En glish.A great n umber found the British gen erally reserved, particularly the En glish, although one Australian visitor called the English "the frien dliest people in the world and most hospitable". But she did admit that speaking the same Ian guage was a great help.Some Asia n bus in essme n, who had traveled widely throughout En gla nd, said quite ope nly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much ni cer", one of them said, with a playful smile on his face, "By much ni cer I mea n much more like us!"A few con ti nen tals praised "En glish courtesy", but the majority found it dish on est and dull."Yo u're forever say ing 'please' and 'sorry' whe n you don't feel pleased or sorry," one expla in ed.A young stude nt from South Africa had no views on the matter. He had n't met anyEn glishme n, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scots' English 2) the friendliest people 3) much nicer than 4) En glish courtesy 5) no views on the matter/ nocomme nts on the matter。
- 1、下载文档前请自行甄别文档内容的完整性,平台不提供额外的编辑、内容补充、找答案等附加服务。
- 2、"仅部分预览"的文档,不可在线预览部分如存在完整性等问题,可反馈申请退款(可完整预览的文档不适用该条件!)。
- 3、如文档侵犯您的权益,请联系客服反馈,我们会尽快为您处理(人工客服工作时间:9:00-18:30)。
Unit 3Part OneExe 2 D C B E AExe 3 T F T T T T F F T FPart TwoListening IExe 1 BCDA Exe 2 FTFTFTListening IIExe 1 BDADExe 2 30s, male, 1.90, long wavy, heavy built, light red sweater, beardListening IIIExe 1 BCDA Exe 2 1, 4, 5, 7Part ThreePractice OneExe 1 1) natural riches, 2) desert, 3) extinction, 4) species, 5) oxygen, 6) economic development, 7) conservation, 8) valuable income, 9) awareness, 10) slow downExe 2 TFFTPractice TwoExe 1 FFTTExe 2 1) South America, pet food, enough protein, develop2) much more, Asia, Africa3) position, natural resources, gone down, steady4) continued to rise5) getting richer and richerPractice ThreeExe 1 1) the few seconds, 2) so thin, 3) beings from another planet, 4) focused on, 5) looked directly at, 6) All around, 7) until now, 8) despair grief and disgust, 9) started crying, 10) who was sleeping peacefullyExe 2 1,2,3,5,8Practice FourExe 1 BCACExe 2 love, together, mother, house, school, friends, father, month, beach, callPart FourSection I complained about, work, got out of, on the ground, shocked, cold-blooded killing, investigation, drug dealing, concern, against, strong views, using drugs, too early, respectable, accused ofSection II CBABCSection III 1) overcrowded cities, 2) poverty, disease, 3) the drift, 4) registration, 5) resentment, 6) attractive, 7) education services, 8) rural lifeUnit 4Part OneExe 2 1) computer programmer, 2) computer engineering, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical, 9) management, 10) 3600Exe 3 1,2,4,6,8,9,11,12Part TwoListening IExe 1 2,3,4,5,7Exe 2 1)weaknesses, 2) similar abilities and interest, interest us, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combination Listening IIExe 11)Choose their careers, 2) avoid certain careers3) different professions, 4) children’s impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignoranceExe 2 TTFTFTPart ThreePractice OneExe 1 DDABExe 2 sales manager, salary, sales commission, a car, travel round in, experience, university, on a team Practice TwoExe 1 BBACCExe 2 1) 65 words, 2)90 to 100 words, 3) with languages, translate letters, answer the phone, foreign visitors, second foreign languagePractice ThreeExe 1 CABDBExe 2 1) ADF 2) BF 3) ACEPractice FourExe 1 1) sensitive extroverted, 2) kids, 3) doing a good job, 4) tolerance level, 5) patientExe 2 TFTFTPart FourSection I1.100 million2.35 to 403.7 to 84.Office workers, many professionals5.8:00 to 4:006.eight-hour shifts7.Monday, Thursday, Saturday, Sundays8.choose their own working hours, freedom of choice, happy withSection II DAACDSection III BCCDAUnit 5Part OneExe 2 BACEDFExe 31.over long distances2.look into it3.five times4.individual, group5.sex-specific, males, females, strangers6.great apes7.teach, own kind8.raised, held, look bigger9.round, tail-wagging10.feeding, every directionPart TwoListening IExe 11.plays, real people, real life, emotional problem, loyalty, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kindExe 2 FFTTTTListening IIExe 1 CADExe 21.be understood easily2.necessary, desirable3.splendid4.prevents, from achieving5.anxiety, effectPart ThreePractice OneExe 1 DABABExe 21.permission, apply for2.application form, Web site3.regular mail, fax4.traveler’s checks, credit cardsPractice TwoExe 1 2,3,5Exe 2 TFFTTTExe 3 1) other native languages, 2) two, 3) more, 4) of their choice, 5) Spanish, 6) Indians Spanish, 7) English, 8) German, 9) FrenchPractice ThreeExe11.learner, teacher, curriculum2.aptitude, expectations, goalsexe 2 TFTFTPractice FourExe 1 CCABExe 21.Eggs, Toast2.realistic, goals, far better than, forgetting3.determined, personality, culture,4.unusual, recite aloudPart FourSection Ireligions, exist, 40000, cave, moon, birth, records, agree, by, sense, ourselves, inhabitSection II FTFTFTTTSection III ADCDBAUnit 7Part OneExe 2 CBCDAExe 31.fun holiday2.natural scenery, historical interest3.summer, too cold4.long history, vast territory5.feed the monkeys6.as many places as possible7.you name it8.host city, ancient civilization, modern architecture9.city wall, treat yourselves10.express trainsPart TwoListening IExe 1 CBBCDAExe 2 SN 862 SN 86317:50, July 11 15:10, July 14 Listening IIExe 1 BCFGHIExe 21.FTTT2.FFTF3.TTTTFPart ThreePractice OneExe 1 ADHEExe 2 CDBCPractice TwoExe 1 seedy, company, shared, noisy, early, private, booking, convenient, restaurants, bathroomsExe 2 TFTTFTPractice ThreeExe11.Fuel2.Water3.Vehicles4.clothesExe 21.passing lorries2.enough water3.drinking4.vehicle5.emergency6.self-sufficient7.car repairs8.cost much, be costly9.sweaters10.European winterPractice FourExe 1 Occupations: B AHoliday: ABBABAABExe 2 TFFFFTFTPart FourSection I FTTTFSection II BCCCADSection III DBCDAUnit 9Part OneExe 2 CCCWWCCCCWWWCWWCWW Exe 31.prefer, old-fashioned2.as old as,3.account for4.own, play, earn a living5.very proud of6.1.5 billion, had the chance7.hills, small bridges, singing of birds8.full of energy9.holes, buttons, precise notes10.indirectly, individualistic11.places great importance on12. a universal languagePart TwoListening IExe 11.restaurants, airports, supermarkets, banks2.a. attitudes, in the right moodb. a better feeling, the people around himc. happy, work better3.a. World War II, happy, calmb. a machine, kind of music, different times, faster, slowerExe 2 TFFTTFTFListening IIExe 11.eases their minds, operations2.classical, instrumental jazz, folk music3. A. reduce tensionB. 50 male doctorsC. MathematicsD. quickly, calmly, chosen for them, No music, the worstE. sleepyExe 2 TFTFFPart ThreePractice OneExe 1 BDACExe 21.their own style2.the nature3.sounds, experimented4.songs, records5.films, awardsPractice TwoExe 1 1. 1) trumpet 2) piano 3) violin2. 2) piano 1) clarinetExe 2 picks the strings, as hard as, make the notes, on the strings, manages the bowExe 3 1) learn, 2) carry, 3) popular, 4) satisfying, 5) progress, 6) easiest, 7) less satisfying, 8) most difficult Practice ThreeExe1 TTTFFFFTExe 2 4, 1, 1, 1, 3, 2, 5, 4, 5, 1, 5, 5Practice FourExe 1 ABACAExe 2 TNTFTPart FourSection I TFFTFTTTSection II 2,4,7,8,10,12Section III falling, nice, cold, inside, raining, tears, happen, arms, fire, gone。