新编大学英语视听说教程第三册答案

合集下载

新编大学英语视听说教程3答案

新编大学英语视听说教程3答案

新编大学英语视听说教程3答案1. A: What did you think of the movie we watched last night?B: I found it quite captivating. The storyline was unique and the acting was superb.2. A: Did you attend the lecture on climate change?B: Yes, I did. The speaker provided a lot of insightful information and raised awareness about the urgency of addressing this issue.3. A: Why did you choose to study psychology?B: I have always been fascinated by the human mind and behavior. Psychology allows me to understand and help people better.4. A: Have you read the latest novel by your favorite author?B: Not yet. I'm currently in the middle of another book, but I'm looking forward to starting it soon.5. A: How was your interview for the internship?B: It went well, I believe. I was able to showcase my skills and experiences effectively and I had a positive rapport with the interviewer.6. A: What do you think are the key factors for successful teamwork?B: I think effective communication, mutual respect, and a shared goal are crucial for successful teamwork.7. A: Did you enjoy the concert last night?B: Absolutely! The band performed exceptionally well and the atmosphere was electric.8. A: How do you manage your time effectively as a student?B: I make use of a planner and prioritize my tasks. I also try to eliminate distractions and set realistic goals for myself.9. A: What are your thoughts on the use of technology in education? B: I believe that technology enhances the learning experienceand provides opportunities for personalized and interactive learning.10. A: Have you ever traveled to any foreign countries?B: Yes, I have. I have been fortunate to visit several countries, and each experience has been eye-opening and enriching.。

【精品】新编大学英语第三版视听说3听力答案(Unit1-Unit6)

【精品】新编大学英语第三版视听说3听力答案(Unit1-Unit6)

Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问,应选C,请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √ 2×3×4√Jack 1 √ 4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11.FTFT2.South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1)import from abroad 2)sales manager 3)salary 4)sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√C×D√E×F√G×H√I√J2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√B×C√D√E×F√G×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1:Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2:1.1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√ 5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1)a.whales and dolphinsb.birdsc. tigers2)a. meat oilb.handbags shoesc.furd.ivory2.TFTT。

【VIP专享】新编大学英语视听说教程3(第二版)_听力完整答案

【VIP专享】新编大学英语视听说教程3(第二版)_听力完整答案

~~~Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm 5) strength 6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private 5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed 10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. T Practice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. T Section III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species 5) oxygen 6) economic 7) conservation 8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa¥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ¥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11.plays/ real people/ real life/ emotional problem/ loyalty/ popular2.public speech / make themselves taller/ political one-sided3.soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11.learner/ teacher/ curriculum2.aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat8. clean9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4.vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5,7,1,4,6,3,2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently15. read 16. exceptional 17. preparation 18. fully Section II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W 11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.W Exercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11.restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel:musicalBranford Marsalis: brilliant, humorousYoussou N’Dour:not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31.terrible rubbish / deafening/ stand2.slow-paced/ peaceful3.concentration on them4.dreamt of / afford5. dwell on the past / more freedom5.keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21.N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11.work, family, health, friends, spirit2.work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying 10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious16. angel 17. grave 18. nights 19. days 20. taste。

新编大学英语视听说3文本及答案Unit9

新编大学英语视听说3文本及答案Unit9

Unit 9Part OneAlice: Listen! The sound of that music! It...it's fascinating! Where...where is it from?Xiao Hong: Oh, I...I don't know actually.Henry: Over there! Shall we go take a closer look?Alice & Xiao Hong: OK.Xiao Hong: Oh, it's a kind of Chinese folk instrument called pipa.Alice: Wow, what a beautiful musical instrument!Xiao Hong: Sure.Henry: What's more, it makes such a marvelous sound!Xiao Hong: Oh, I'm glad to hear you say that. Actually, our folk instruments are quite unique. You know, the sound is beautiful and, as you see, it looks good. But, still, unfortunately, they are getting less popular these days.Alice: Really? That's incredible. You know, our Scottish bagpipes, which are some of the oldest instruments in the world, are still quite popular.Xiao Hong: Well, I'm afraid it's not the case in our country. Y ou know, I'm not exaggerating. Nowadays the vast majority of young people prefer western music to Chinese folk music, and they think Chinese folk music and classical instruments are old-fashioned.Henry: What a pity! Many people listen to bagpipes and they are heard on all kinds of different occasions. I wonder why Chinese folk instruments, as old as those bagpipes, are so little appreciated today.Xiao Hong: Well, I think historic reasons may partly account for it. You know, in ancient times, most of the Chinese folk instruments were used to please and entertain the nobles. You know, they were too expensive for ordinary people to own and play unless the poor played them in the street to earn a living.Alice: I know that some Chinese emperors loved music and had a good taste in it.Xiao Hong: Oh, yes, like Tang Xuanzong, but his ministers were firmly opposed to it. They believed that the emperor's attention might be distracted from ruling the country if he spent too much time on music. And they seemed to think of music as something trifling and unimportant. Henry: But things are quite different in our country. Our people are extremely interested in music, and are very proud of our traditions. We view music as part of our lives.Alice: Y eah, and our government spends a lot of money on music education. In the year 1999——2000 for example, the Department of Education spent 1.5 billion dollars on teaching music 1999so that lots of children had the chance to learn to play musical instruments.Xiao Hong: I do wish that more people would appreciate the exquisite melody of our folk instruments and be proud of our traditions.Henry: What's the difference between western music and Chinese music?Xiao Hong: Well, young people think that western music is more exciting and passionate. The rhythm is stronger, which makes them feel more excited. Well, on the other hand, the Chinese music is harmonious, soft, gentle, mild and calm. It helps make people feel peaceful, comfortable and relaxed.Alice: Y es, there are differences between Chinese music and...and western music, but one isn't really better than the other.Xiao Hong: No, no, no. Absolutely not. When I listen to Chinese music, the beautiful melodyalways reminds me of the beauty of nature, hills, streams, small bridges and the singing of birds. You know, the melody is like the music of the nightingale, the music of running water and etc. But western music is more upbeat and exciting. I get full of energy and I want to dance and sing with it. I like rock music better than folk music actually.Henry: Rock and roll has a long history in western countries. There are plenty of bands playing different kinds of rock and roll music, like heavy metal and punk.Xiao Hong: And most of our Chinese musical instruments are made of wood, bamboo or something like that, so the music sounds natural while yours nowadays are mostly made of metal and they seem to be much more complex.Alice: Right. Take our flutes for example. They have more holes and buttons, so they rely on very precise notes to produce music.Xiao Hong: What's more, western singers are usually good at dancing while they sing, but our singers are usually only good at singing.Henry: I suppose because of cultural differences, Chinese, like their music, are usually more reserved.Xiao Hong: There are still some people who prefer Chinese folk music. The pop music nowadaysis increasingly dominated by western music.Alice: I guess people are immediately attracted to western music, but Chinese music has the mysterious power to attract you without you realizing it.Xiao Hong: Y eah, Chinese traditional culture has made a deep impact on Chinese music. Y ou know, the music emphasizes people's feelings and is very emotional.Alice: I've heard that the structure of western music is more logical than that of Chinese music.Xiao Hong: I find that the lyrics are different too. Chinese people tend to express their emotions indirectly while western people are more direct and individualistic. They make full use of music and instruments to express their personal feelings, such as excitement, disappointment, love, sorrow and etc.Henry: Western music has absorbed many musical elements from African music. It places great importance on rhythm, such as heavy metal music, rock music, hip hop and so on.Alice: Yes, and, of course, we have a number of well-known composers these days.Henry: Mm, nowadays it seems that rock and pop music dominate the musical world. In many pieces of music, one instrument can be used in order to produce a distinct sense of perception.Xiao Hong: I guess, eventually, because of globalization, the differences between western music and Chinese music may become less noticeable. You know, in the future, the music may have a lot more in common than we have realized now.Alice: Oh, as far as pop music is concerned, what you say is probably true, but even though musicis a universal language, folk music shouldn't be changed.Xiao Hong: That's right. Don't you think it would be a good idea to buy some Chinese folk music CDs to take home with you?Alice & Henry: That's a good idea! Let's go to the CD shop.Exercise 21.C2.C3.C 4,W 5,W 6.C 7.C 8.C 9.C 10,W 11.W 12.W 13.C 14.W 15.W 16.C 17.W 18.WExercise 31.perfer old-fashioned2.as old as3.account for4.own play earn to living5.very proud of6.1.5 billion had the chance7.hillls small bridges singing of birds8.full of energy9.holes buttons precise notes 10.indirectly individualistic 11.places great importance12.a universal languagePartTwo Listening I(Bill, Howard, and Lisa are talking about background music.)Part IBill: What are you working on now?Howard: I've just finished a piece of background music.Lisa: Background music? Oh, like the music they're playing here now. Howard: Yes. You hear it everywhere, in restaurants, airports, supermarkets, department stores... Bill: In banks, too. I noticed it while we were at the bank today.Lisa: Did you? I didn't.Howard: Y ou are not supposed to notice it. It's just there, in the background. It's supposed to influence your attitudes, and put you in the right mood.Lisa: I'm not sure I like that idea.Howard: Well, it seems to work. Companies pay millions of dollars every year for background music. It's supposed to give you a better feeling about yourself and the people around you. Factories use it a lot. It makes the workers happy, and they work better that way. In one factory, music increased production by 4.5 percent.Bill: I should think they'd get tired of hearing music all day.Howard: They don't though. One fellow in San Francisco told me, "If the music stops, somebody always runs to the telephone to complain."Lisa: Now that I think about it, I can't remember when there wasn't background music in restaurants and stores.Howard: That shows how young you are. Actually, it all started during World War II when some factories had their own orchestras to keep workers happy and calm. Now, of course, the music is piped in by a machine, and different kinds of music are played at different times during the day. They play faster music at 10 in the morning than at 8, for instance, because workers tend to be slower then.Part IIBill: What about restaurants? Do they play the same music for dinner and lunch?Howard: I don't know about that, but I do know that hamburger places play fast music. When they started playing faster music, they found that a customer spent only seventeen minutes eating. The time was 22 minutes before that.Lisa: So they have more people coming in and out to buy hamburgers.Howard: Exactly. And that's good for business. You can see why music has become so popular. In Los Angeles, for instance, 30 different companies are selling background music services. Lisa: I still think there's something about it that I don't quite like.Howard: I know what you mean, but lots of people wouldn't agree with you. The Xerox Corporation in Rochester, N. Y Corporation in Rochester, N. Y., spends more than $80,000 a year for background music. Prisons ., spends more than $80,000 a year for background music. Prisons use it, and farmers use it to keep their cattle calm. It's even supposed to have an effect on plants.Exercise 11.restaurants airports supermarkets 12,attitudes in the right mood the people around him happy work better 3.World War II happy calm a machine kinds of music different times faster slowerExercise 21.T2.F3.F4.T5.T6.F7.T8.FListening IIMore and more doctors are operating to music. They say it eases their minds.One doctor in Chicago says classical music is the only kind that does not interfere while he is operating. But in another Chicago operating room, the British rock group Pink Floyd can be heard. And in Washington, at least one doctor operates to the sound of the Beatles.Researchers from the State University of New Y ork at Buffalo did a study that seems to confirm that music helps reduce tension in doctors. They gave fifty male doctors difficult mathematical kinds of tests.The doctors did the test while listening to music they themselves had chosen. They did a similar test while listening to music that was chosen for them. They were tested a third time with no music at all. Each time, a machine measured their heart rate and blood pressure.The doctors worked most quickly and calmly when listening to the music they themselves had chosen. They did the worst with no music at all.What kinds of music did the doctors choose? Mostly classical. But some chose instrumental jazz pieces or Irish folk music.There probably is one piece of music that should never be played during an operation: Brahms' "Lullaby". You do not want your doctor to go to sleep while operating, do you? Exercise 11.eases their minds operations2.classical instrumental jazz folk music3.A reduce tension B. 50/fifty male doctors C. Mathematics D.1)quickly 2)calmly 3)chosen for them 4)No music 5)the worst E. sleepyExercise 21.T2.F3.T4.F5.FPart ThreePractice OneThe Beatles were probably the most important pop and rock group of all time. They were together for only eight years, but their influence has lasted much longer.The Beatles came from Liverpool, England. They started playing together in 1962, although Paul McCartney and John Lennon played together in another group. They started by playing rock'n' roll songs, but they quickly developed their own style. By 1963, they had become Britain's top rock group. A year later they toured the United States, where they attracted millions of fans.By the time the Beatles broke up in 1970, they had changed the nature of rock and pop music. They introduced new sounds and rhythms, and they experimented with different types of musical instruments. They recorded hundreds of songs and they sold millions and millions of records. They made many films and won many awards for their music.Today, the Beatles' songs are still very famous all over the world.Exercise 1B D A CExercise 21.their own style2.the nature3.sounds experimented4.songs records5.films awardsPractice Two(Dennis is interviewing Stephanie, a music teacher.)Dennis: Which do you think is the easiest instrument for people to learn to play?Stephanie: It's difficult to answer that question because learning to play an instrument is one thing, and learning to play it well is another. But I think the guitar is the easiest to learn. It's one of the easiest to carry, and that's important for a musician.Dennis: And the second?Stephanie: My second choice is probably the most popular instrument, and I think it's the most satisfying, too, because you can make more progress at the beginning. That's the piano.Dennis: So you think playing the piano's more difficult than playing the guitar.Stephanie: Yes, because, well, your left hand has to work as hard as your right and both hands have to make notes. With the guitar, you make the notes with the left hand, and the right just picksthe strings.Dennis: Is playing a woodwind or brass instrument very difficult? It looks quite easy.Stephanie: I think the clarinet and the trumpet are the easiest to learn. Finding the notes is quite easy and breathing isn't a serious problem. But I find all the wind instruments less satisfying for people to play, because you can't do much alone. You have to play with others.Dennis: And which do you think is the most difficult instrument to play?Stephanie: No doubt at all, the violin. And I think it's the most difficult because both hands have to work, but they have to do different jobs. I mean, the left hand makes the notes on the strings, andit's harder to find the notes than on the guitar because the strings are shorter. The right hand has to manage the bow, and bowing well is an art. Finally, the most difficult thing about it, I find, is holding the instrument under your chin. It's not a natural position to adopt.Exercise 11.(1)trumpet (2)piano (3)violin 2(2)piano (1)clarinetExercise 21.picks the strings2.as hard as3.makes the notes4.on the strings5.manages the bowExercise 31.learn2.carry3.popular4.satisfying5.progress6.easiest7.less satisfying8.most difficultPractice Three(Four people, Steve, Connie, Diane, and Martin, are giving their opinions about their favorite musicians before attending an international concert.)Steve: Oh, no doubt about it. My favorite's Bruce Springsteen. He's the best there is. I think he's more direct, he communicates better than the others. It's not that the others are bad, but he's better.In a way his kind of rock music's more old-fashioned than, er, Sting's, say, but for me it's moreexciting. And the messages in his songs are simpler. They're easier to understand than Sting's or Peter Gabriel's, so I can relate to them better.Connie: The singer I want to hear most is Peter Gabriel. He's not really one of my favorite singerssingers——I mean I don't think he's as exciting as Bruce Springsteen, for instance—but his latest songs, these African songs with African rhythms, well, they're more musical than pop songs usually are. And I think all the singers are sincere about the human rights movement, but he feels more deeply about it than the others.Diane: Oh, I think Sting and his band are the best. Sting's better now with his new band than during his time with the Police. He seems more natural and I think he enjoys playing more. And he's a much better songwriter now. The one I like most in the band is the sax-player, Branford Marsalis. He plays brilliantly, but the best thing about him is his sense of humor. He really makes me laugh!Martin: To tell you the truth, I'm looking forward most to hearing Youssou N'Dour. I like Peter Gabriel's African songs, but he's an Englishman, not an African, so it's not the same as the real thing. I mean, real African music is different from reggae and rock, because it's more rhythmic than reggae, but not as heavy as rock. The rhythms are very unusual, too, and more sophisticated than people think.Exercise 11.T 2,T 3,T 4.F 5.F 6.F 7.F 8.TExercise 2Musicians BruceSpringsteen Sting PeterGabrielBranfordMarsalisYoussouN’Dourbrilliant √ communicative √direct √exciting √musical √natural √Not so heavy √ humorous √rhythmic √ simpler √ sophisticated √ unusual √Practice FourIt has long been known that Cellist Yo-Yo Ma possesses astonishing musical talent. By age seven he had already played for Isaac Stern and Pablo Casals. Later he went to Juilliard and on to Harvard, where he studied international cultures. Soon he tasted stardom, giving concerts around the world.But he tells of a humbling experience while in Namibia, where he went to observe trance dances and musical rituals of the people. At the end of his stay he produced a cello and offered them a performance of his own. "They said, 'Stop. Don't play. We want to play for you, '" Ma remembers with a laugh. "I think I was too self-important to bring my cello. They didn't give adamn."His story is one of a star realizing that not everyone knows or cares who he is. "To be a good performer, you have to have a very strong ego," he says. "But to be a really good performer, you have to make sure that your ego is not the center. To play Beethoven, you have to figure out who he was, and how that's encoded in the music. And then you have to realize you are not Beethoven."Exercise 11.A2.B3.A4.C5.AExercise 21.T2.N3.T4.F5.TPart FourSection 1Some people called John Lennon the "thinking man's Beatle". He was serious and creative, and many young people of the 1960s and 1970s thought he spoke for them.Lennon was born on October 9,1940, in Liverpool, England. During his childhood he listened to the music of rock 'n' roll singers like Elvis Presley, Jerry Lee Lewis, and Little Richard. At 15, when he was in an art school, Lennon started his first band, the Quarrymen. The band included Paul McCartney, George Harrison, and Pete Best, a drummer.The Quarrymen later changed their name to the Silver Beatles and then the Beatles. Ringo Starr replaced Pete Best as drummer. Between 1958 and 1962 the group played in nightclubs in Liverpool and Hamburg, West Germany. Then the Beatles made a record called "I Wanna Hold Your Hand" and changed the history of rock 'n' roll.Many people think that Lennon was the most important singer and songwriter of the Beatles. In general, his songs are sensitive and intelligent, and they still influence today's popular musicians.On December 8, 1980, a confused young man shot John Lennon outside his apartment building in New York City. A few days later, thousands of people gathered in New York's Central Park to remember him. For them, and for many other people in the world, he was someone very special.1.T2.F3.F4.T5.F6.T7.T8.TSection IIRock began in the U.S.A. in the early 1950s. At that time, "rhythm and blues" music was very popular with black Americans. "R&B" was a mixture of black religious music and jazz. It had strong rhythms that you could dance to and simple, fast lyrics.Noticing the success of R&B music, white musicians started to copy the same style. By the mid 1950s, this new white R&B music, called "rock 'n' roll", had become very popular. Singers like Elvis Presley and Bill Haley attracted millions of teenage fans. Their music was fast and loud. Many older people thought that rock 'n' roll was very dangerous.Rock music has continued to change and develop. It has combined with music from different parts of the world. Today, there are hundreds of different types of rock music, and almost every country has its own form of rock. There are "heavy metal" which is extremely loud with hard rhythms, "reggae" from Jamaica that combines rock with jazz and Latin rhythms, "rap" that hasdeveloped on the streets of New York, "disco", a type of soft rock music for dancing, "Afro-rock" that combines rock with African rhythms, "Mex-rock", which combines rock with traditional Mexican melodies...and many, many more.1 2√ 3 4√ 5 6 7√ 8√ 9 10√ 11 12√Section IIIBig Big Worldby Emilia*I'm a big big girl in a big big worldIt's not a big big thing if you leave meBut I do do feel that I do do will miss you muchMiss you muchI can see the first leaf fallingIt's all yellow and niceIt's so very cold outsideLike the way I'm feeling inside(Repeat the part marked with "*".)Outside it's now rainingAnd tears are falling from my eyesWhy did it have to happenWhy did it all have to end(Repeat the part marked with "*".)I have your arms around meWarm like fireBut when I open my eyes, you're gone(Repeat the part marked with "*".)I'm a big big girl in a big big worldIt's not a big big thing if you leave meBut I do feel I will miss you muchMiss you much1.falling2.nice3.cold4.inside5.raining6.tears7.happen8.arms9.fire 10,gone。

新编大学英语视听说book3Unit4听力答案及文本

新编大学英语视听说book3Unit4听力答案及文本

新编大学英语视听说book3Unit4听力答案及文本1Unit 4Part OneListening IFor many of you this will be your last year at university and now is the time for you to begin thinking seriously about your future careers. In order to give you as much help as possible, I have quoted a list of questions that you ought to ask yourself.First, "Have I got a clear knowledge of my abilities as well as my interests?" Be honest about your weaknesses as well as your strengths. Take a really good look at yourself and give real thought to the kind of person you are, and what kind of person you want to be.Second, "Do I know the kinds of occupations in which people like myself tend to find success and satisfaction?" Talk to people who have similar abilities and interests and who are already in the careers that interest you. You can gain some idea of what they consider to be important and challenging in those careers. Watch these people at work.Third, "Have I weighed carefully the immediate advantages against the long-term prospects offered by the jobs I am considering?" Will the occupation you select give you satisfaction in the years to come? Realize now the importance of education in all fields, technical and professional. Remember that chances of promotion are usually given to educated persons—other things being equal.Fourth, "Have I talked with my parents, my teachers and my headmaster?" Remember they have a lot of experience that you can benefit from. They can help you think about the jobs. Theycan stimulate you to give careful thought to what you really want to do, and offer useful suggestions about how you might take full advantage of your personal qualities and qualifications.Last, "How do I regard my job? Is it just a means of getting money to do the things that I want to do? Is the work important to my future happiness? Is it a combination of both?"The above questions and their answers should give you some better ideas about how you should start planning your career. Your life-long job cannot be approached in any kind of haphazard fashion. It must be considered carefully, examined from every angle, and talked over with those who know you and those who can help you in any way.Exercise 12、4、5、6、8Exercise 21. weaknesses2. similar abilities and interests / interest you/ important and challenging3. education/ promotion/ educated persons4. parents/ teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II(Here's a dialog between a woman whose job is to help people find jobs and a man looking for a job.)Woman: Look. Here's a job that might interest you.Man: What is it? Are you sure? The last job interview you sent me off to was a disaster.Woman: Well, look. It says they want a sales manager, and it looks like it's a big international company. That'd be good. Youmight get to travel.Man: What kind of company is it, though?Woman: Um, let's see. Yes, it's a textile company that seems to import from abroad. They say the salary is really good. They operate a system of paying you a basic salary and then offering you a sales commission on top of that. They say it is high. And oh, look! They give you a car to travel round in. That's not bad, is it?Man: Um, do they say anything about experience?Woman: Um, let's see. No, they want someone young with ambition and enthusiasm. Oh yes, they want graduates, so that's OK. You've been to university. Now what else? Let's see.Man: There must be some catch.Woman: No, the only thing is you have to travel, but then that's what the company car's for. Oh, and you have to be able to get on well with other people because it says you have to be good on a team.Man: Um, perhaps I'll have a closer look at that one.Exercise 11. D2. D3. A4. BExercise 21. import from abroad2. sales manager3. salary4. sales commission5. travel in6. experience7. university8. on a teamListening IIIInterviewer: Some people feel that their jobs are misunderstood by others. Is that very common?Sociologist: Oh, absolutely. Most jobs or professions have an image or stereotype attached to them, and some of these are not realistic. The serious point is that young people choose their careers based on these false images, and they may even avoid certain careers which have a negative image. This can cause problems for the economy.Interviewer: Is there evidence of this problem?Sociologist: Yes, there was a recent survey of children's attitudes to different professions.Interviewer: How was this done? Children don't know much about jobs and professions.Sociologist: True. What the investigators wanted to get was children's impressions and prejudices. They gave the children twelve pairs of statements, one of the pair positive, and the other negative. Children were asked to say which of the statements was "most true" for each profession.Interviewer: For example?Sociologist: Well, for example, "Such and such a person is likely to be boring or interesting company."Interviewer: I see. What professions did they ask about?Sociologist: The list is long, but it included lawyers, economists, accountants, sales representatives, scientists and engineers.Interviewer: And the results?Sociologist: Well, they are striking, especially for engineerswho came out much worse than one might expect. About 90 percent of the children thought that engineering was a "dirty job", of "low status", and the engineer was more likely to take orders than to give them. The only other person they thought more likely to lose his job was the sales representative. But, there were good points too. Engineering was seen to be "interesting, well-paid work".Interviewer: Hmm, not a rosy picture.Sociologist: No, but it got better when children were asked what they thought of the engineer as a person. Most of them chose positive comments, but most thought the engineer was likely to be badly dressed.Interviewer: What about other professions? What were the most popular?Sociologist: Oh, the lawyers by far. Next came accountants and scientists as well as economists. The engineers and sales representatives were the least popular.Interviewer: Sounds like a sign of the times.Sociologist: Yes, but I think the most serious implication was the children's apparent ignorance of the importance of the engineer's role in society.Exercise 11. choose their careers2. avoid certain careers3.different professions4. impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. F3. T4. F5. TListening IVMegan: Tim, if you could pick any occupation in the world, what do you think would be a cool one?Tim: Well, truth be told, i think it would be pretty awesome to be a commercial fisherman. Megan: Fisherman! Why would you want to be a fisherman?Tim: Believe it or not, i’m really fascinated by the ocean. I like spending time in the ocean and I think if you go out on those boats and get away from the land, you really get in touch with the sea.Megan: Is it dangerous, though?Tim: Oh, it can be dangerous, for sure. You can get caught in storms. It can be rough sometimes.Megan: Do you get paid a lot of money?Tim: Not so much, but that is not necessarily vital. You know, you can work with nature. You can catch healthful food, provide for yourself, and I think that’s really fulfilling. How about you , Megan? What do you think would be a cool job?Megan: I think I would like to be a writer.Tim: Why is t hat? Lots of writers don’t succeed in making much of a living.Megan:Well, being a movie star would be exciting too, or a rock star, but the fame is overwhelming—too many peoplealways want to talk to you or want your autograph. I think as a writer, you are doing something you love without all that pressure or the media coming after you, and you can sort of make your own workk schedule and do it where you like. You can write in the countryside in a cabin, or you can write in the city wherever you please. So, I think it is a very flexible, rewarding job.Tim: Yeah, you’ve got to have the aptitude for it, though. Do you think you have what it takes?Megan: No, not yet. I’m a terrible writer. But anyway, if I could have my pick of jobs, I’d like to be a writer.Exercise 11. C2. A3. C4. B5. DExercise 21. occupation, cool2. catch, provide, fulfilling3. media coming after you, making your own work schedule4. have my pick of jobsPart 4Further ListeningListening IThere are at least 100 million workers in the Unites States. Most of them are on the job 35 to 40 hours a week. Their typical day includes seven to eight hours of work. Usually, they have a 15-minute coffee break in the morning and in the afternoon. But work schedules vary from job to job.White-collar workers—office workers and manyprofessionals—usually have "nine to five" jobs. They begin at 9:00 a.m. and finish at 5:00 p.m. Monday through Friday. "Blue-collar" workers—mechanics, electricians, and laborers—often work from 8:00 a.m. to 4:00 p.m. In many factories, blue-collar workers come to work in eight-hour shifts. Typically, these shifts start at 8:00 a.m., 4:00 p.m., and midnight. Finally, sales people and managers in retail stores work on Monday and Thursday nights, when the stores are open. Many retail workers also work on Saturdays, and some work on Sundays.These are the normal schedules for most American workers. However, many businesses now use a new system called "flex-time scheduling". Under this system, the employees choose their own working hours. Some people work from 8:00 to 4:00 five days a week. Some work from 9:00 to 5:00. Other people work 10 or 12 hours a day four days a week. Employees and managers are both happy with the system. The employees like the freedom of choice, so they work hard. The managers, of course, like the hard-working employees.What, then, is a typical work schedule? It depends on the job—and on the workers.Exercise:1. 100 million2. 35 to 403. 7 to 84. office workers, many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday ,Thursday, Saturdays ,Sundays8.choose their own working hours, freedom of choice , happy withListening IIMan: How long have you worked for AM-ADMEL, Gill?Woman: Only for a year. It's May now, isn't it? Yes, I joined last August in fact.Man: August in 1996.Woman: Yes.Man: What did you do before that?Woman: I used to work for a travel agency in London.Man: It was interesting, wasn't it?Woman: Not really. It was just secretarial work, rather like this job. And it wasn't too well-paid. But I took a secretarial course when I left school and I couldn't think what else to do.Man: So you went straight from school into a secretarial course, didn't you?Woman: Well, not quite. I left school when I was 16, in 1989, I think it was. And then I went to work in a hotel in Austria for a year, to learn some German.Man: Austria? Why Austria?Woman: I don't know really. Well, we used to go there on holiday quite often when we were younger, and, well, I like Austria actually. Anyway then I went back and did the secretarial course. That was a year's course.Man: And then you got the job at the travel agency I suppose.Woman: Yeah, that's right. That was in 1991.Man: So you were there for five years!Woman: Yes, it's awful, isn't it? Actually, I'm thinking of giving it all up to become a nurse.Man: Really?Woman: Well, I worked in a hospital in Twickenham during my last year at school. Just cleaning and helping to make bedsand so on. It was part of our Practical Careers training.Man: And you liked it?Woman: Yes, it was interesting.Exercise1. A2. D3. C4. A5. DListening IIIMan: Well, now then, one thing I'd like to ask is, er, exactly why you applied for the job. I mean, just looking at your application form, you're actually over-qualified...Woman: Yes, I thought you might ask that. Um, the thing is, in my present job, although I'm actually in charge of a small team and I have a lot of responsibility, it's largely a desk job with a lot of paperwork...Man: And you're not too keen on being stuck in an office all day?Woman: To be honest, no, I'm not. I much prefer being out on site where I can supervise things, and deal with problems as they occur. And this job should give me the kind of contact with other engineers, architects, builders and so on.Man: Mmm. You'd certainly have to do quite a lot of traveling in the local area, you know, visiting different sites. You do realize, though, that the starting salary isn't as good as the salary in your present job?Woman: Yes, I realize that, but um, it does say in the job advertisement that the promotion prospects are very good.Man: That's true, and er, as this is a new project that we'reworking on, we think there'll be a very good chance of fairly quick promotion, depending on performance, that is...Woman: Yes, of course. Well, you see, I've got very little chance of promotion in my present job.I mean it's a very small company and there's nowhere really for me to go; that's why I'm looking around for somewhere else.Exercise1. C2. B3. D4. C5. AListening IVDavid: Hi! You're listening to Radio Southwest, the best in the southwest for music andup-to-the-minute news. Sue's here. Hello, Sue.Sue: Hello, David.David: And we've got the Jobspot for you today. So, if you're looking for a new job, this could be the spot for you. So, let's have a look, and see what we've got today.Sue: Well, the first one we've got is a cook. That's in a large, busy restaurant, so it's very useful to have had experience in cooking. Must be a high school graduate and the pay is $12 an hour. So that's not bad, is it? The hours are good too. That's Monday to Friday, 3:00 p.m. till 6:00 p.m.David: Great. Thanks, Sue. So that's a cook. Now, how do you fancy working out of doors? How do you fancy being a gardener? So as long as you're fit and strong, and at least 16 years old, that'll suit you. The pay is $8 an hour. And the hours, Tuesday to Saturday, 8:30 a.m. to 5:00 p.m., you have to work on Sundayonce a month, but on Monday the Garden Center's closed. Now, the sort of work you'd be doing is potting, watering, things like that. So, how about applying for that? Pay, $8 an hour. Sue, what else have you got?Sue: Right, Dave. Well, from outdoors to indoors. We've got a word processor operator job here. This job might suit a woman with school-age children, because the hours are only 15 hours a week. It's a small, friendly office, and they require a high school graduate with two years' experience operating a computer. Pay is $9 per hour. So, there you go. That's a nice job in an office. If you fancy any of those jobs, give us a ring here on Jobspot at Radio Southwest. And now back to the music.Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACE。

Removed_新编大学英语视听说教程3答案

Removed_新编大学英语视听说教程3答案

4) Peter A G I
Practice Three Exercise 1
1. Pedro energetic
2. Mr. Miller patient
3. Mr. Smith honest
4. Jake stubborn
5. Mrs. Duke creative
Practice Four Exercise 1
6. unner-up
Exercise 2
1. T 2. F 3. T 4. F 5. F 6 T
Practice Two Exercise 1
1. Four 2. Colleagues 3. Teacher 4. Susan 5. Barbara\
Exercise 2
1) Paul D E J 2) Susan B F 3) Maria C H
1. T 2. F 3. T 4. T 5. F 6. F
Listening III Exercise 1
1) stayed around 2) mouse catcher 3) rats and mice
Part Two Listening I Exercise 1 1. B 2. B 3. A 4. B 5. C Exercise 2 1. T 2. F 3. T 4. T 5. F 6. T
Listening II Exercise 1
1. A 2. A 3. B 4. C 5. C
Exercise 2
Unit 1 Part One Exercise 2 1. Mike C 2. Sam E 3. Ted D 4. Simon A 5. Lilly B Exercise 3 1. avoid power 2. social outgoing 3. reputation 4. despite wittiest 5. make up for protective 6. describes 7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristics

全新版大学英语 视听说教程3答案

全新版大学英语    视听说教程3答案

UNIT1Part1C: 1)g 2) i 3) d 4) a 5) f 6) h 7) e 8) c 9) b 10) jD:TFTTE: segment 11.Facebook, 24, more than 30 billion2.difficult, rapid3.television,investors4.Bill gatesSegment 25.a cafe, seven6.Free timeSegment 37.one third,half8.30,bankruptcySegment 49.marriage/family life10.divorced,choseF: 1. It is very hand work to have your own business.2.There is no guarantee of becoming rich as a business owner.3.You have to make difficult choices between family and work.Part2A:1)b 2)a 3)c 4)bB:(1)get read for work (2)never (3)sense of power (4)12 (5)desire for power(6)a leader (7)fist restaurant (8)fighting with the chef (9)hing(10)speed(11)second year (12)shut the restaurantC:1)a 2)b 3)d 4)bD:1. the chef the wait staff2.brighter than me out of their way3.daring and creative new challenges new ideasE:1)c 2)b 3)c 4)bF:FTFTG:1)d 2)a 3)b 4)bH:1. $50,000 to $80,000 a month.2.To finish school and become a doctor.3.His company was making $66 million a year .4.Dell is one of the largest computer companies and earns nearly $80 billion ayear.5.He did not have a passion for computers and drive to succeed in business Part4C: 1) c 2)b 3)a 4)b 5)a 6)b 7)a 8)a 9)c 10)aD: 3,4,5E: Segment 1:1.By taking life and education seriously for 17.Segment 2:2.Choices you will have to make.3.Make mistakes.4.Decision-making.Segment 3:5.Yes.6.To work hard for more success.Segment 4:7.Yours.8.Celebrate your achievement.G: 1)b 2)b 3)c 4)c 5)a 6)bUNIT 2Part 1C: 1. i 2. d 3. a 4. e 5. h 6. c 7. g 8. f 9. b 10. jD: 2,4F:b,f,c,a,e,dG:segment 1:1.Simple pictures.2.Punctuation or other non-letter symbols.3.A combination of two words to make one word.4.Basketball/Sunlight.5.Picture.6.Character.Segment 2:7.Facial expressions and gestures.Segment 3:8.Abbreviations.9.“u” for you.Part 2A: 1)c 2)b 3)c 4)dB:1. 5.2 billion.2.Inherited knowledge , diversity, the culture of former speaker3.Awareness, endangered language-preservation projects.4.Record and upload.5.Hear the words, learn the language.C:1)b 2)c 3) dD:1)T 2)F 3)F 4)F 5)FE:1)a 2)b 3)bF:1. They enjoy playing with the language and actively invent new vocabulary,2.To express new ideas and objects.3.Because England was once ruled by French-speaking Normans.4.By using prefixes and suffixes.G:1)d 2)a 3)cH:2. invented to describe sounds and the things that make sounds;also invented byrepeating a sound with a small change.3. invented by reducing phrases.4. the shortening of a longer word,often reducing it to one syllable.5. combining elements from two words.Part 4B:1,2,C:1)c 2)b 3)b 4)c 5)c 6)b 7)a 8)a 9)a 10)aD:4.E: a:1b:2, 3,5C:4, 6F:segment 21.T2.FSegment 33.T4.F5.T6.FG: segment 1: cSegment 2: aSegment 3: b,d,eSegment 4 :d,eH:1. boutique2.Thunderstorm3.Camcorder4.Flame5.LOLUNIT3Part1C:1) h 2) j 3) c 4) b 5) d 6) g 7) e 8)a 9)f 10)iD:1, 3, 5,8,E:Dogs: 1, 2, 3, 5, 6, 10,Rates:4, 5, 6, 9,Ravens:3, 5, 7, 8, 9,F:segment1: who used dogs for search and rescue in the 17th century?Segment 2: what other skill did the dogs have?Segment 3: what kind of technology are they using?Part 2A:1)c 2)b 3)d 4)bB:1. it was a magnitude 7.0 earthquake.2.Three million.3.An immediate response to the crisis.4.Crisis mapping.5.Crowd-sourced data.C:1)b 2) b 3)a 4)cD:1. gym2.Black3.154.1685.High energy6.FocusE:1)b 2)b 3)c 4)bF:1.can, a force for good in society, yes, it can2.does, help many people, yes, a force for goodG:1) T 2)F 3) T 4)T 5)T 6)FH:1)b 2)b 3)c 4)aI: 1. 2013, small earthquake2.saving many lives.3.water, food and tents.4.500 tents, 1250 blankets, earthquake survivors.5.nearly,health,Part 4D:1)b 2)a 3) b 4)a 5)b 6)c 7)a 8)b 9)a 10)aE:1, 2,G:1.a,b,e,h,k2.a,b,f,h,k,3.a,c,j,h,i4.a,d,h,j,UNIT 4Part 1C:1)b 2)a 3)c 4)b 5)c 6)c 7)b 8)c 9)a 10)aD:1) N 2) T 3) F 4)F 5)T 6)FPart 2A:1)c 2)a 3)b 4)c 5)dB:(1)born (2)5 (3)father (4)looking after (5)10 (6)farmland (7)40(8)cook (9)fried (10)steak (11)gas station (12)gas station (13)motel(14)66 (15)restaurant (16)spices (17)KFC (18)second (19)restaurant(20)20000 (21)hot (22)adaptable (23)hotC:1) c 2)a 3)c 4) c 5)bD:1.eliminate, how you limit yourself, input2.Focusing only on your strengths and denying your weaknesses.3.They may not always be accurate.E:1)a 2)c 3)bF:1) F 2)F 3)T 4)FG:1)c 2)d 3)a 4)bH: example one(1)disease (2)speak (3)control (4)left leg (5)child (6)write (7)draw(8)painter (9)best-selling writerExample two(1)slave (2)united states (3)forbidden (4)read (5)write (6)bread(7)reading lessons (8)escape (9)freedom (10)salve (11)leaders(12)slavery (13)autobiography (14)best seller (15)persuaded(16)abolish slaveryPart 4D:1) T 2)F 3)T 4)T 5)T 6)F 7)T 8)F 9)T 10)FE:1. 2. 3.F:d.g.f.e.a.b.c.UNIT5Part1C:1) b 2)g 3)i 4)c 5)d 6)h 7)j 8)e 9)f 10)aD:1.c 2.b 3.a 4.b 5.bE:segment 1(1)heart (2)blood (3)rate (4)brain (5)muscles (6)fastSegment 2(7)releasing (8)stress (9)high (10)relax (11)killPart 2A:1)b 2)b 3)c 4)cB: To sign up for activities promising stress relief ,to learn new techniques toCope with stress ,and to find all means and ways to manage their stress.D:2对E:1)b 2)bF:1.In 20182.It assessed the primary and junior high school education sectors in China.3.Advanced preparation4.The desire to succeed remains fierce among Chinese students and parents.G:1)c 2)b 3)d 4)d 5)aH:Tip 1: (1)break (2)listen to some musicTip 2:(3)exercise (4)play basketballTip 3:(5)laugh and smile (6)a comedy (7)read a humorous storyI:1)c 2)c 3)bJ:Tip 4:(1)reach out to others (2)talk to (3)send them a letter or an emailTip 5:(4)sit quietly (5)think about (6)the waters rushing by (7)all yourworrier awayK:1.对Part 4C:1)a 2)a 3)b 4)b 5)b 6)b 7)c 8)bD:1)b 2)c 3)a 4)a 5)aUNIT 6part 1C:1. b 2.j 3.d 4.c 5.e 6.i 7.f 8.h 9.a 10.gD:2.对E:1: e, g2: h, c3: a, b, i, d, fF:(1)human life (2)Fishing (3)more than 500 million (4)food (5)work(6)protect (7)barrier (8)coast (9) they prevent or reduce (11)scuba diving(12)scientific (13)medicines for (14)contribute (15)30-1723H:(1) reefs (2)so (3)to (4)ocean (5)health (6)habitats (7)lots(8)of (9)species (10)can (11)you (12)link (13)directly (14)to(15)ocean (16)healthPart 2A:1)c 2)c 3)dB)1. nearly 900 dolphins.2.Bleeding and fractures in dolphins’middle ears,and probably decompressionsickness.3.It can cause then to die.4.The ability to identify predators.D:1)b 2)b 3)c 4)cE:1.In the ocean.2.For about 40 years.3.Water and noise pollution,overfishing, heavy water traffic and the reduction offree-flowing water.4.The government designated important ecological areas along the river.F:1)a 2)d 3)bG:(1)70% (2)half of the oxygen (3)the climate (4)most of our rain(5)global warming and climate change. (6)natural remedies(7)get their income (8)more than one billion.J:(1) ocean garbage (2)trapped and die (3)plastic (4)humans (5)floats(6)plastic (7)one place (8)lift (9)water (10)recycling (11)acidification(12)CO2 (13)CO2 (14)shellfish (15)plants (16)CO2 (17)oxygen(18)bubbles (19)CO2 (20)escape (21)escapeK:1)c 2)d 3)d 4)a 4)aPart 4D:3.4.5.E:1)F 2)F 3)F 4)T 5)F 6)T 7)F 8)F, T 9)TG:segment 1 1)a 2) b Segment 2 2)c 4)b Segment 3 5)b Segment 4 6)A。

新编大学英语视听说教程第三册标准答案

新编大学英语视听说教程第三册标准答案

Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5.travel around in 6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice Two(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。

新编大学英语视听说教程第三册听力答案

新编大学英语视听说教程第三册听力答案

Keys to the texts of book3Unit sixPart OneExercise 2 :1. d2. a3. b4.c5. c6. aExercise 31. farm animals; hold; feed2. small pets; toys3. buy; toss them out4. real shame5. dangerous; destructive ; bring diseases6. have a points7. humanely; limit8. time; money; warm place9. isolated; company 10. storm of debatePart TwoListening IExercise 11. b2. c3.d4. bExercise 21 T 2. F 3.F 4. F 5. T 6. TListening IIExercise 11.Her son.2. snake; crocodile3.quiet4.picky/particular Exercise 21. big2. dogs3.tiger4. bit5. cat6. friendly 6. eat 8. clear 9.wash 10.space 11. noisy 12. train 13. speak 14.keep 15. quietPart ThreePractice oneExercise 1(1,4,5,6,7,) yesExercise 21 a 2.b 3.c 4.a 5. dPractice TwoExercise 1(1,3)yesExercise 21. for free2.small donation3. 204. hundreds5. eat little6.50 7. animal shots 8. numerous shots 9. diseasesPractice ThreeExercise 11.c2.b3.d4.c5.aExercise 2(2,5.6.7) yesPractice FourExercise11 c 2.c 3. a 4.b 5. dExercise 21.crowding water; grass;2. what is happening; low3.targetpractice; over the area4. gotten rid of; stayPart Four Testing yourselfSection I1.f2. t3. f4. t5. f6. t7. t 8. f 9. f 10. tSection II1. a2. c3. d4. b5. b6. bSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5000 12. embarrassed 13. advertise the furs 14. export bans 15. importation 16.turtleKeys to the texts of book3Unit sevenPart OneExercise 2 :1. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery ;historic interest3. Summer ; too cold4. long history ; vast territory5. feed the monckys6. as many places as possible.7. you name it8.. host city ;ancient civilization; modern architecture9. city wall; treat yourselves 10.express train Part TwoListening IExercise 11 c 2. b 3. b 4. c 5. d 6. aExercise 21. SN 862 17:50 on July 112. SN863 15:10 on July 14 Listening IIExercise 1(B.C.F.G.H.I) yesExercise 2Part one 1.F 2. T 3.T 4.T Part two 1.F 2.F 3T 4.F Part three1.T2.T3.T .4.T5.FPart ThreePractice oneExercise 1Advantages: ADH ; disadvantages: EExercise 21 c 2.d 3.b 4. cPractice TwoExercise 11. seedypany3.shared4. noisy5. early6. private7. booking8. convenient9. restaurant 10.bathroomsExercise 21. T2. F3. T4. T5.6. TPractice ThreeExercise 11. Fuel2. Water3. Vehicles4. ClothesExercise 21.passing lorries 6. self-sufficient2.enough water 7. car repairs3.drinking 8. cost much4.vehicle 9. sweaters5.emergency 10. European winter Practice FourExercise1a. actress Bb. actress and author A1. a2.b3.b4. a5.b6. a7. a8. b Exercise 21.T . F 3. F 4. F 5. F 6. T 7. F 8.TPart Four Testing yourselfSection I1.F2.T3.T4. T5. FSection II My history teacher1. b2. c3. c4. c5. a6. dSection III1. d2. b3.c4. d5. aKeys to the texts of book3Unit eightPart OneExercise 2 :Section A5,7,1,4,6,3,2Section B1)F H I 2)A 3) C E J 4) B D G JExercise 31.passed out; in shock2. back and forth3. knows the reason why4. no doubt; living without her5. plays a great role6. brilliant boy7. very few cases8. deny; nature9. bright or not; should; CAN 10. thicker than; genetic relationship 11. react to; not to mention 12. hard decision; involvedPart TwoListening IExercise 11 F 2. F 3. T 4. F 5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed 8. language 9. young 10. alike 11. separated 12. apart 13. career 14. interestsListening IIExercise 11.b2.d3. a4. dExercise 2(1,4,6,8,10,11,12 ) yesPart ThreePractice oneExercise 1(3,6,9) yesExercise 21. six2. four3.1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice TwoExercise 11. 19212. fit the child3. ordinary schools4. adult conception5. BarbaraExercise 21. good being2.wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars 10. scholars 11. street cleanersPractice ThreeExercise 11. c2.b3. c4. bExercise 21 F 2. F 3. T 4. F 5. FPractice FourExercise11 a 2. c 3. d 4. aExercise 21.F2. T3.T4. T5.T6. TPart Four Testing yourselfSection I1.talent2.dancing3.creative4. early5. physical6. energy7. less8. curiosity9. particularly 10. cause 11. fundamental 12. meaning 13. superior 14. fluently 15. read 16. exceptional 17 preparation 18. fullySection II1.F2. T3. F4. F5. T6. F7. F8. TSection III1. c2. a3. c4. b5. dKeys to the texts of book3Unit NinePart OneExercise 2 :1. c2. c E3. .c4. w5. w 6 c 7. c 8. c 9.c 10. w 11. w 12. w 13. c 14. w 15. w 16. c 17. w 18. wExercise 31.prefer; old- fashioned2. as old as3. account for4.own; play; earn a living5. very proud of6. had the chance7. hills; small bridges; singing of birds8. full of energy9. holes; buttons; precise; notes 10.indirectly; individualistic 11. places great importance on 12. a universal languagePart TwoListening IExercise 11 restaurants, airports supermarkets; banks 2. attitudes; in the right mood ; a better feeling; the people around him; happy; work better 3. world war II 4. happy; calm ; a machine; kinds of music ; different times; faster ; slowerExercise 21. T2. F3.F4.T5.T6. F7. T8.FListening IIExercise 11.eases their minds; operations2. classical; instrumental Jazz;folk music 3. reduce tension; 50 male doctors; Mathematics ; 1. quickly 2. calmly 3. chosen for them 4. no music 5. the worst sleepyExercise 21. T2. F3.T4. F5. FPart ThreePractice oneExercise 11. b 19622.d 19633.a 19644. c 1970Exercise 21. their own style2. the nature3. sounds; experimented4. songs; records5. films ; awardsPractice TwoExercise 11. (1) (2) (3)2.(2) (1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the string5. manages the bowExercise 3.1. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice ThreeExercise 11. T2. T3. T4. F5. F6. F7. F8. TExercise 2。

新编大学英语视听说教程3听力标准答案

新编大学英语视听说教程3听力标准答案

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly BExercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. T Exercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 T Practice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection II1. B2. B3. D4. B5. D6. A7. C 8. BSection III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. C Exercise 21. T2. F3. T4. T5. F6. F Listening III Exercise 11) stayed around 2) mouse catcher 3)rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7.F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. D Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7.F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction4) species5) oxygen 6) economic 7) conservation8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa¥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ¥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. F Exercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. B Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.T Exercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by10. sense11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. A Exercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debate Part TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.D Exercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory10. reduced11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. A Exercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages E Exercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathroomsExercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7)A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. D Section III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5,7,1,4,6,3,2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.T Part Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16.C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makesthe notes4. on the strings5. manages the bow Exercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. TExercise 2Bruce Springsteen: communicative, direct, exciting, simplerSting: naturalPeter Gabriel:musicalBranford Marsalis: brilliant, humorous Youssou N’Dour:not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damaged Exercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. A Section II 1. C 2. B 3. D 4.A 5. B Section III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black11. white 12. shaking 13. wet 14. sweet15. delicious16. angel 17. grave 18. nights 19. days 20. taste。

新编大学英语视听说第3册听力原文和答案

新编大学英语视听说第3册听力原文和答案

新编大学英语视听说第3册听力原文和答案新编大学英语视听说第3册听力原文和答案Interviewer: Angela, you were born in Korea but you've been livingin Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I havetwo personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian. Interviewer: That sounds complicated. Could you explain what you mean?Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to whatis polite? Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person? Angela: Yes, but sometimes I don't know who I am.I am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others aregoing through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself.I don't like people doing things for me, or helping me, or giving me things.It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything. I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask. I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. Itmakes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Tom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing,bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different. Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in theMiss California Beauty Pageant two years ago. Well, you're probably not interested. Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!David: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile...He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot ofquestions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite agrown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and Ithink that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it?Have a good holiday, won't you?Barbara: Thanks.David: Bye.1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chairhe wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then youcan sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room inthe school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?A number of visitors to the UK, who had traveled throughout theBritish Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Somewere very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularlythe English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found Northcountry people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!" A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. Hehadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself. Statements:1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitora lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors.One day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was moresensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at thefly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not.I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee. Tom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. T aylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything. Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test. Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!(S1 = the first speaker; S2 = the second speaker; S3 = the third speaker; S4 = the fourth speaker)S1: In this week's edition of Up with People we went out into the streets andinterviewed a number of people. We asked a question they just didn't expect. Weasked them to be self-critical...to ask themselves exactly whatthey thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard.S2: Well...I...I don't know really...it's not the sort of question you ask yourself directly. I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretaryby the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street... Well...then I see someone a bit different. Yes...I'm different in my private life. And that's probably my mainfault I should say... I suppose I'm not coherent in my behavior. Myoffice is always in order...but my flat! Well...you'd have to see it to believe it.S3: Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4: Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven.I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.Mike: Hey, guys. Come and look. I've found an interesting Web siteon star signs. (The others come close to the computer and look at thestar signs on the screen.)Ted: Hey, that's interesting! What's your sign, Sam?Sam: I'm a Scorpio. What's yours, Ted?Ted: I have no idea. I've never really thought about that. Let's have a look. I was born on September 5. Oh, I'm a Virgo.Simon: And I'm a Libra.Sam: What do they say about Libra, Simon?Simon: (He reads.) You're a sociable, charming person. You go out of your way to avoid confrontation and do everything in your power to make your life an easy one. Although you're generally likeable, you can be changeable, superficial and critical. But you manage to hide thosetraits most of the time.Mike: Do you agree with that? Are you that type of person?Simon: What do you think? I think there is something in what it says.I am social and outgoing. But I am not changeable, am I? What's your sign, Mike?Mike: I'm a Taurus. Ah, what's yours, Lilly?Lilly: I'm a Cancer.Ted: Now let's look at Taurus.( He reads.) You're a patient,practical type. Goodpoints include your affectionate, kind nature, your trustworthiness and strength of character. Bad points include your possessiveness, self-indulgence and stubbornness. Do you think your character fits well?Mike: No, not at all. I'm not patient, and I'm not practical either.I am kind of quick-tempered and ambitious. That's definitely not me! But one thing is right: I AM stubborn.Simon: Sam, let me read yours. (He reads.) You are secretive, and sexy. You have theworst reputation in the zodiac. Scorpio has a dark side, which includes revengeful and destructive traits. Yet despite this, you can be the wittiest, kindest and most entertaining of all the signs.Sam: Oh, that can't be true! Are you sure you were reading Scorpio?Simon: Yes, of course! Look for yourself.Sam: But that's unfair! I have the worst reputation in the zodiac?!The others: (They all laugh and say.) Ha ha... Poor Sam!Sam: Who could believe such silly things! Really, I think I'm intelligent, humorous, and kind-hearted.Mike: Yes, but those are just your good traits. Don't forget about your bad ones! Sam: Come on! Oh, Lilly, we haven't looked at your sign yet. Eh, you are a Cancer, right? You want me to read yours?Lilly: No, thanks. I'm afraid you'll distort what's written there.Let me read it myself. (She reads.) To some people, you appear tough and determined, but that's just a "front" you put up to protect the real you, which is rather more sensitive and softer. You can be moody, touchy and irritable, but you make up for those negative traits with your kindness, great intuition and protective nature. That's not bad, is it?Simon: No. But what counts is not what it says, but how you really are, what you are actually like.Lilly: (She is a bit defensive.) What do you mean? What are youtrying to say aboutme?Simon: I think you are much nicer than what it describes.(Lilly smiles.)The other boys: Oh, Simon, don't sweet-talk her! We know what youare thinking. Ted: Hey, I haven't seen mine yet. Now it's my turn.Mike: Go ahead, Ted! Be our guest!Ted: It says: Virgo people like order in all things and are neat, clean and precise in their habits. Virgo people are perfectionists and they sometimes can be critical. They do not like to draw attention to themselves. Virgo people are modest, and careful about what they eat or drink.Sam: Do you have any objections to that?Ted: I think the description matches me quite well. I AM a perfectionist. I like things to be in order. Erm, I...I'm careful about what I eat and drink. But it doesn't mention my weak points.Lilly: Oh! And what are those?Ted: Well, sometimes I'm so careful I tend to waste a lot of time.I'm not very sociable, and I don't have many friends.Sam: I think everyone has some undesirable personality traits that could be improved. Don't you think we all could improve our personalities?Mike: I think we can. For example, my little sister was the youngest girl in our family. My parents loved her very much, but they spoiled her by giving her too much. She was at that time self-centered, selfish,aggressive, bad-tempered, and rude. Her personality didn'tchange any until she entered primary school. In school, she first acted as she did at home, and she couldn't make a single good friend. For a time, she was even isolated by her classmates. She complained to us, and finally understood her problem. From then on, she made every effort to get rid of her undesirable characteristics both at home and in school. Now she's in middle school and has turned into a popular girl.Lilly: In my opinion, our personalities are partly inherited and partly shaped by our home environment. As we all know, scientists have found that parents' personality traits can be seen in their children. Most children have some of their parents' personality traits.Mike: That's right. And our early home and school environment also has a big influence on the shaping of our personality. For instance,I've noticed that many children growing up in rich families may become wasteful, lazy, arrogant or cold. On the other hand, I've noticed that many children raised in poor families are hard-working, caring, sympathetic, and helpful.Sam: Does that mean you think we have to choose our parents wisely?(The others laugh.)2Mart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I hadthis good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I shouldsend her out there. It was a cold day in the fall. Well, she tookright off and away she went. But she didn't show up when it got dark. I began to worry about her. She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and seeif I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was this dog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth."There was an old man who had a daughter. He told his daughter thathe had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten themall up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen hisknife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papa invitespreachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled to the preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these."Jack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat.So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his woodenone. In no time, that cat had eighteen mice piled up in front of the mouse hole.Ken: Hey, Josh. Where did you get those comic magazines?Josh: When I went home last weekend, I found these old Superman magazines that my older brother had bought manyyears ago.Ken: You don't have time to read old comics. Why did you bring them here? Josh: In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken: Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh: When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken: How?Josh: Superman is an orphan who comes by rocket to Earth when his native planet explodes. He lands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work and consideration for others. As an adult, he migrates to a large city and defends Americans against evil.Ken: What else?Josh: Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken: But how does that relate to Superman?Josh: He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values ofhonesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken: I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh: OK.At one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs insteadof only for food. Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painfulstiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you."The spirits of the deer would run to the place where a deerhad been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If theanswer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again.Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them. When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a。

新编大学英语视听说3Unit1听力原文和答案

新编大学英语视听说3Unit1听力原文和答案

Unit 1Part OneListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian.Interviewer: That sounds complicated. Could you explain what you mean?Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to what is polite?Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person?Angela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you suffer and cry for people you don't know, or over a movie that’s only a story, then I think that's a little too sensitive. That's the way I am.I am also a very independent person. I must do things by myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like; and I would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell others any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BListening IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody andself-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different.Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. self-centered5. blond medium height6. runner-upExercise 21. T2. F3. T4. F5. FListening IVDavid: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susan5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter A G IFurther ListeningListening IOne day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) swearing 8) perfectly 9) wildly 10) beeListening IITom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. Taylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything.Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7. D8. C1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. Miller D patient3. Mr. Smith E honest4. Jake A stubborn5. Mrs. Duke F creativeExercise 21. favorite way to relax2. how to divide3. bad unripe4. stiff sore5. fastening a basketball hoopA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scot s’English 2) the friendliest people 3) much nicer than 4) English courtesy 5) no views on the matter/no comments on the matter。

新编大学英语视听说教程3(十单元)听力标准答案

新编大学英语视听说教程3(十单元)听力标准答案

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being aware Exercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) English1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beard1. B2. C3. D4. AExercise 21.4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species5) oxygen 6) economic 7) conservation 8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America, pet food, enough protein, develop2. much more, Asia ,Africa3. position, natural resources, gone down, steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease7. education services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ¥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and pre judices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy with Section II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Exercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particular Exercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train 13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.T1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking8. convenient9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. T1. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A5,7,1,4,6,3,2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13.careers 14. interestsListening II Exercise 11. B2. D3. A4. D1. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.W1. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic 11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slower Exercise 21. T2. F3. F4. T5.T6.F7. T8. F Listening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel:musicalBranford Marsalis: brilliant, humorousYoussou N’Dour:not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. T Exercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying 10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 11. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 11. T2. T3. F4. F5.F6.T7.F8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days8. give up9. stop trying 10. encounter risks 11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious 16. angel 17. grave 18. nights 19. days 20. taste。

新编大学英语视听说教程第三册答案.doc

新编大学英语视听说教程第三册答案.doc

Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5.travel around in 6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice Two(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。

新编大学英语视听说教程第三册答案

新编大学英语视听说教程第三册答案

Keys to the texts of book3Unit OnePart OneExercise 2 :1.Mike C2.Sam E3..Ted D4.SimonA 5.Lilly BExercise 31.avoid; power2.social; outgoing3.reputation;4.despite; wittiest5. make up for; protective6.describe7.perfectionist; critical8.matches9.traits; improved 10.get rid of; characteristicsPart TwoListening IExercise 11 F 2.F 3.T 4.F 5.T 6.TExercise 21.outside world2.at home3.wave hello4.bow5.look straight in the eye6.openly7.look at my feet 8.shy and silentListening IIExercise 11.sensitive; caring2.good friend3.life; people4.leaving ; being awareExercise 21.b2. c3.a4.d5.bPart ThreePractice oneExercise 11.ice-skating2.chemistry3.outgoing;bright; funny4.moody; self-centered5.wavy blond; medium size6.runner-upExercise 21 T 2.F 3.T 4.F 5.F 6.TPractice TwoExercise 11.42.collogues3.teacher4.Susan5.Barbara Exercise 21.DEJ2.BF 3CH 4.AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energeticler patient3.Mr.Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2.T 3.F 4.F 5.TExercise 2flattering 2.critical 3.popular 4.reserved 5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2.sensible3.lecture4.calm5.strengthnded7.waving 8.perfectly 9.wildly 10.beeSection II My history teacher1.b2. b3. d4. b5.d6. a7. c8. bSection III What do you think of yourself?1.secretary2.hardworking3.efficient4. private5.army officer6.help7.fond8.independent9.shy 10.fifteenUnit TwoPart OneExercise 2 :1. C2. E3.D4.B5.AExercise 31.in your hand; used to belong2.practicing with3.talk to each other; why not4.ask for; find a way5. manage to; his own love6.so foolishly jealous7.all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4.B 5.CExercise 21 T 2.F 3.T 4.T 5.F 6.TListening IIExercise 11.a2. a3.b4.c5.cExercise 21.T2.F3.T4.T5.F6.FListening IIIExercise 11.stayed around2.mouse catcher3.rats and mice4.got a paw5. weak and thin6.make a wooden paw7.fastened it8.grow sleek and fat9.managed10.peered out cautiously11.seized it with 12.eighteen micePart ThreePractice oneExercise 11.b2.a3.a4.c5.d Exercise 21 F 2.T 3.T 4.F 5.T 6.F 7.F 8.T Practice TwoExercise 11.C DJ2.AEGH 3BFI Exercise 21.a2.b3.d4.c5.b6.d Practice ThreeExercise 11.b2.d3.c4.d5.aExercise 21 F 2.T 3.F 4.F 5.F 6.TPractice FourExercise11.b2. c3. b4. a5.d6. a Exercise 21 F 2.F 3.T4.T 5.FPart Four Testing yourselfSection I Little Red Riding Hood1.c2. b3. c4. b5.a6. cSection II Spider, Hare and moon1 T 2.F 3.F 4.F 5.T.6.F 7.T 8.TSection III The legend of the cowboy1.18672.shippedlionairend5.cattlelion7.cowboys8.camera9.hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2.C3.B4.E5.AExercise 31.T2.F3.T4.T5.T6.T7.F8.F9.T10.FPart TwoListening IExercise 11.b2.C3.d4.aExercise 21 F 2.T 3.F 4.T 5.F 6.TListening IIExercise 11.b2.d3.a4.dExercise 21.30’s2.male3.1.904.long ; wavy5.heavily built6.light red sweater7.beardListening IIIExercise 11.b2.C3.d4.aExercise 2(1.4.5.7).yesPart ThreePractice oneExercise 11.natural riches2.desert3.extinction4.species5.oxygen6.econimic development7.conservation8.valuable income9.awareness 10.slow downExercise 21 T 2.F 3.F 4.TPractice TwoExercise 11.F2.F3.T4.TExercise 21.south America; pet food; enough protein; develop2.much more; Asia; Africa3.position; natural resources; gone down; steady4.continue to rise5.getting richer and richer Practice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5.looked directly at6.All around7.until now8.despair grief and disgust9.started crying 10.who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4.house5.school6.friends7.father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3.got out of4.on the ground5.shocked6.cold-blooded killing7.investigation 8.drug dealing mon 10.against 11.strong views ing drugs 13.too early14.respectable 15 accused ofSection II1.c2. b3. a4. b5.cSection III1.over-crowded cities2.poverty disease3.the drift4.registration5.resentment6.attractivecation services 8.rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3.internship4.lecture; competitionputer programming skills6.impatient7.constructive8.medical research9.management 10. 3,600Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21.weaknesses2.similar abilities and interests; interest us; important and challengingcation ;.promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5.getting money; our future happiness; combinationListening IIExercise 11.choose their careers2.avoid certain careers3.different professions4.children’s impressions and prejudiceswyers6.accountants7.scientists8.most popular9.least popular 10.ignorance1.T2.T3.F4.T5.F6.TPart ThreePractice oneExercise 11 d 2.d 3.a4.bExercise 21.sales manager2.salary3.sales commission4.a car5.travel around in6.experiences7.university 8.on a teamPractice TwoExercise 11.b2.b3.a4. c5.cExercise 21.65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign languagePractice ThreeExercise 11.c2.a3.b4.d5.bExercise 21.ADF2.BF3.ACEPractice FourExercise1sensitive; extroverted 2.kids 3.doing a good job 4.tolerancelevel 5.patientExercise 21 T 2.F 3T 4.F 5.TPart Four Testing yourselfSection I1.100 million2.35 to 403.7 to 84.office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8.choose their own working hours; freedom of choice; happy withSection II1.d2. a3. a4. c5.dSection III1.b2.c3.c4.d5.aKeys to the texts of book3Unit FivePart OneExercise 2 :1.B2.A3.C4.E5.D6.FExercise 31.over long distances2.look into it3.five times4.individual; group5. sex-specific;; males; females; strangers6.great apes7.teach ; own kind8.raised ; held; look bigger9.round ; tail-wagging10.feeding; every directionPart TwoListening IExercise 11.plays; real people; real life; emotional problem; loyalty2.public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2.F 3.T 4.T 5.T 6.TListening IIExercise 11.c2. a3.dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5.anxiety; effectPart ThreePractice oneExercise 11.d2.a3.b4.a5.bExercise 21 permission ;apply for 2.application form; web site 3.regular mail; fax 4.traveler’s checks; credit cards Practice TwoExercise 1(2.3.5) yesExercise 21.T2.F3.F4.T5.T.6.TExercise 31.other native languages2.two3.more4.of their choice5.Spanish6.Indian’s Spanish7.English;8.German 9.FrenchPractice ThreeExercise 11.learner; teacher; curriculum2.aptitude; expectations; goalsExercise 21.T2.F3.T4.F5.T.Practice FourExercise11 c 2.c 3.a 4.bExercise 21.eggs and toast2.realistic; goals; far better than; forgetting3.determined; personality .culture4.unusual ; recite aloud Part Four Testing yourselfSection I1.religions2.exist3.40,0004.cave5.moon6.birth7.records8.agree9.by 10.sense 11.ourselves 12.inhabit Section II1.F2.T3.F .4.T5.F6.T7.T8.TSection III1.a2.d3.c4.d5.b6.a。

新标准大学英语视听说教程3全版答案

新标准大学英语视听说教程3全版答案

新标准大学英语视听说教程3全版答案Unit 1Part I1. b) To explore the rich history and culture of the town.2. c) It is located near a popular National Park.3. a) Being exposed to a diverse range of music.4. b) Encourage students to express their own opinions.5. c) Enhancing the overall learning experience.6. b) Enhancing students' listening skills in real-life situations.7. c) To improve your listening and speaking skills in the shortest time possible.8. a) Enhance their overall language proficiency.9. b) Practice listening and speaking skills through interactive exercises.10. c) Students will be provided with more opportunities to practice listening and speaking.Part IISection A11. B. They find it more accessible and convenient.12. C. They can manage their own time and schedule effectively.13. C. It provides various resources for different subjects.14. B. To offer widespread access to educational materials.15. A. Some students struggle to adjust to the independence and self-discipline required.16. C. Online courses offer a flexible learning environment.17. B. Students need to be self-motivated to succeed in online courses.18. A. It allows students to learn at their own pace.19. C. The tutor is responsible for guiding and assisting students throughout the course.20. B. Online courses provide a range of multimedia resources for different learning styles.Section B21. C. By creating interactive and engaging learning materials.22. A. To make learning more enjoyable and effective.23. B. They allow students to visualize abstract concepts and ideas.24. D. By incorporating educational games and simulations.25. A. Online platforms provide a space for collaborative learning.26. B. Technology enhances the learning experience for students.27. C. It provides students with immediate feedback on their progress.28. D. By offering personalized learning pathways for each student.29. A. Multimedia resources improve students' retention and understanding of content.30. B. By incorporating real-life examples and case studies into the curriculum.Section C31. B. It allows students to develop social and emotional skills.32. C. By providing opportunities for teamwork and cooperation.33. D. It promotes a sense of belonging and community among students.34. A. Extracurricular activities help students develop leadership skills.35. C. It encourages students to explore their interests and passions.36. B. By organizing cultural exchange programs and events.37. D. Extracurricular activities provide a break from academic pressures.38. A. It helps students develop time management and organizational skills.39. C. By providing opportunities for students to take on responsibilities.40. B. Extracurricular activities contribute to the holistic development of students.Unit 2Part I1. B. They facilitate effective communication between team members.2. A. To ensure everyone understands their responsibilities and tasks.3. C. It helps prevent misunderstandings and conflicts within the team.4. A. By setting clear expectations and goals for the team.5. B. It encourages open and honest communication among team members.6. C. To promote collaboration and mutual support within the team.7. B. Teams are more likely to achieve their goals when members trust and support each other.8. C. They allow teams to reflect on their performance and make necessary improvements.9. A. By recognizing individual contributions and achievements.10. B. Feedback should focus on both positive aspects and areas for improvement.Part IISection A11. B. It allows individuals to express themselves freely.12. C. It encourages divergent thinking and creativity.13. A. The fear of being criticized or judged by others.14. B. To explore new ideas and possibilities.15. C. It promotes a positive and inclusive learning environment.16. B. It can hinder personal and professional growth.17. A. By providing constructive feedback and support.18. C. They can provide valuable insights and perspectives.19. B. It contributes to the overall success and innovation of a group.20. A. By fostering a culture of open-mindedness and respect.Section B21. B. Empathy plays a crucial role in developing strong interpersonal relationships.22. A. To better understand and connect with others.23. C. It helps individuals navigate conflicts and resolve issues effectively.24. B. Empathy enhances communication and collaboration within a team.25. A. It allows individuals to consider different perspectives and viewpoints.26. C. They can better support and assist those in need.27. B. Empathy promotes a sense of belonging and community.28. A. By actively listening and showing genuine interest in others.29. C. It involves putting oneself in another person's shoes.30. B. Empathy can be developed and nurtured through practice and reflection.Section C31. C. Effective communication is vital for building and maintaining relationships.32. B. It helps individuals express their thoughts, ideas, and emotions.33. D. It ensures that messages are accurately understood and interpreted.34. A. By practicing active listening and paying attention to non-verbal cues.35. B. Effective communication fosters trust and mutual respect.36. C. It promotes positive interactions and reduces conflicts.37. D. Feedback should be specific, constructive, and non-judgmental.38. A. It is important to choose the appropriate medium for communication.39. C. By asking open-ended questions and encouraging dialogue.40. B. Effective communication requires both speaking and listening skills.Unit 3Part I1. B. To provide an overview of the topics that will be covered in the lecture.2. A. To introduce the main focus or argument of the lecture.3. C. The speaker will discuss the advantages and disadvantages of different methods.4. B. To explain the reasons behind a particular phenomenon or event.5. A. The speaker will analyze a historical event or period in detail.6. B. To discuss the implications and potential solutions to a problem.7. C. The speaker will provide examples to support their main points.8. A. To emphasize the importance or significance of a particular concept.9. B. To describe a process or step-by-step procedure.10. A. The speaker will compare and contrast different theories or viewpoints.Part IISection A11. B. It promotes critical thinking and problem-solving skills.12. C. Inquiry-based learning encourages exploration and discovery.13. A. It allows students to apply knowledge in real-life situations.14. B. The flipped classroom model enhances student engagement and participation.15. A. It encourages students to take responsibility for their own learning.16. C. Active learning promotes deeper understanding and long-term retention of information.17. B. It fosters collaborative learning and teamwork among students.18. A. By providing opportunities for students to ask questions and seek clarification.19. C. It prepares students for the challenges of the modern workforce.20. B. The teacher's role shifts from being a lecturer to a facilitator and guide.Section B21. C. It allows students to learn at their own pace and style.22. A. Personalized learning caters to individual strengths and weaknesses.23. B. It promotes student ownership and autonomy in the learning process.24. D. By leveraging technology to tailor instruction to individual needs.25. A. Personalized learning provides immediate feedback on student progress.26. B. It encourages students to set their own learning goals and monitor their progress.27. C. It enables students to explore their own interests and passions.28. D. By offering a wide range of resources and learning materials.29. A. Personalized learning adapts to students' unique learning preferences.30. B. It fosters a positive and inclusive learning environment.Section C31. B. It encourages students to think critically and creatively.32. C. By promoting problem-solving and analytical skills.33. D. Creative thinking allows individuals to generate innovative ideas and solutions.34. A. It fosters a sense of curiosity and exploration.35. C. Creative thinkers are more adaptable and resilient in the face of challenges.36. B. By encouraging brainstorming and divergent thinking.37. D. Creative thinking leads to new discoveries and breakthroughs.38. A. It helps individuals approach tasks and problems from different perspectives.39. C. By providing opportunities for self-expression and originality.40. B. Creative thinking is a valuable skill in both personal and professional contexts.Overall, the New Standard College English Listening, Speaking, and Pronunciation Course 3 provides comprehensive materials for students to enhance their language proficiency. The course covers various topics andsubjects, incorporating interactive exercises to practice listening and speaking skills. Additionally, the course emphasizes the importance of effective communication, critical thinking, and creativity, empowering students to become well-rounded individuals in both academic and professional settings.。

新编大学英语视听说教程三册答案

新编大学英语视听说教程三册答案

Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. Barbara Exercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combination Listening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5. travel around in6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign languagePractice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerancelevel 5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; lookbigger 9. round ; tail-wagging10.feeding; every directionPart TwoListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regularmail; fax 4.traveler’s checks; credit cardsPractice TwoExercise 1(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7. records8. agree9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. aTHANKS !!!致力为企业和个人提供合同协议,策划案计划书,学习课件等等打造全网一站式需求欢迎您的下载,资料仅供参考。

(完整word版)新编大学英语视听说book3Unit5听力答案及文本

(完整word版)新编大学英语视听说book3Unit5听力答案及文本

Unit 5 language1Part 1Listening IEvery culture has its own way of saying things, its own special expressions. These are the living speech of a people. The" soap" expressions in English are just one example.Soap operas are radio and television plays about the problems and emotions in human relationships.They are called soap operas because the first programs-years ago-were paid for by soap-making companies.Like musical operas, soap operas are not about real people. And critics charge that they do not represent a balanced picture of real life. They note that almost everyone in a soap opera has a serious emotional problem, or is guilty of a crime. And there are several crises in every program. Yet, soap opera fans do not care about what the critics say. They love the programs and watch them every day.Such loyalty has made soap operas very popular in the United States. In fact, A few programs are so popular that they have been produced with the same actors for many years.Another expression that uses the w ord soap is “soap box”.There was a time when soap and other products were shipped in wooden boxes. The boxes were small, but strong. You could stand on one to see over the heads in a crowd or to be seen in a crowd. Soap boxes were a simple, easy way to make yourself taller if you wanted to give a public speech. Such soapbox speeches usually were political and one-sided. The speakers shouted their ideas to anyone who walked by. Many talked for hours refusing to get off their soap boxes.Today, you don’t n eed a wooden box to make a soapbox speech. Anyone, anywhere, who talks endlessly about a cause is said to be on a soap box,.Another, quieter way to win support or gain influence is to “soft-soap” a person. This means touse praise or other kind words to get the person to do what you want.Exercise 11. plays,real people,real life,emotional problem,popular2. public speech, make themselves taller, political, one-sided3. soft-soap, praise, kindExercise 2F F T T T TListening IIA: Do you think learners should try to speak English with a native-speaker pronunciation?B: That's a difficult question to answer. I think the most important thing is to be understood easily. For most learners, it's not necessary or desirable to speak like a native speaker. For some learners, for example, those who eventually want to teach English, or be interpreters perhaps, anative-speaker pronunciation is the ultimate goal. At least, that's what I think.A: Children often do not want to speak English with a native-speaker pronunciation. Why not? B: In general, children are splendid mimics and imitate strange sounds very easily and well. However, it is true that most children do not want to sound "English" when they are speaking English. This may be partly due to shyness but I think the main reason is that most children want to belong to a group—they dress alike, listen to the same music, share the same opinions and hobbies. Even if a child can speak English like a native speaker, he or she will usually choose not to—unless, of course, the rest of the group speaks with a native-speaker pronunciation too.A: What is the main reason why adults find pronunciation difficult?B: Numerous reasons have been offered for the difficulties which many adults find with pronunciation and, no doubt, there is some truth in all of these. It seems to be the case that children are better mimics than adults. But if an adult really wants to achieve a native-speaker pronunciation, then he or she can. It is NOT the student's own language that prevents him or her from achieving a native-speaker pronunciation in English. It is the fact that the adult student has a strong sense of national identity. In other words, he or she wants to be identified as a German or Brazilian speaking English. In my opinion, this sense of national identity is more important than other explanations, such as the greater anxiety of adults or the effect of their own language habits.Exercise 11 C2 A 3DExercise 21.be understood easily2.necessary, desirable3.splendid4.prevent, from achieving5.anxiety, effectListening III(Dr.Mallard is an expert on bilingual education. She has a show on radio through which she answers questions from parents about how to raise their children to be bilingual.)Dr.Mallard: Hello, sir. You are on air.John: Oh, hello. Dr.Mallard?Dr.Mallard: Yes, How may I help you?John: Dr.Mallard, my name is John. My wife Maria and I just had our first baby girl.Dr.Mallard: Congratulations, John. You must be very excited.John: Yes, we are indeed. Here is why I called. Maria is from Peru, and speaks fluent Spanish and fairly good English, depending on the situation. I am a native English speaker and I also speak almost fluent Spanish. We live in the U.S and communicate in Spanish at home 95% of the time. Dr.Mallard: I see. Please go on.John: My question is this: how should we communicate in order to ensure the bilingual successof our child?Dr.Mallard: OK. From what you told me I guess you and your wife have already started using mostly Spanish with your newborn girl. Is that correct?John: Yes. I think using Spanish with her just feels kind of natural to both of us.Dr.Mallard: That is fine, because language uses within a family should be natural: we use the languages to build a fa mily relationship, not to “teach” the languages.John: But is it reasonable to assume that our baby will be exposed to enough English in the world outside our house and therefore it will be OK for us to speak to her almost solely in Spanish? Dr.Mallard: Well, in my opinion, yes. And I also believe that your baby will have a lot of exposure to English at home as well. She will listen to not only music and talk on the TV, but also relative and friends who are visiting or telephoning. Besides, she may also have English input from you yourself: for example, you may want to sing to her the English-language nursery rhymes that you remember from your own childhood.John: Ok. That really eases my mind. Thank you so much, Dr.Mallard.Dr.Mallard: You are welcome.Exercise 1T F F F T TExercise 21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IVTalk show host:Welcome to tonight's program. Our guest is Dr. Charles Adams, language learning specialist. His book, Learning a Language over Eggs and Toast is on the best seller list. Welcome.Dr. Adams: Thank you.Talk show host: Tell us about the title of your book.Dr. Adams: First, it is important to establish a regular study program, like planning a few minutes every morning around breakfast time .Talk show host : But, I took Spanish for four years and I didn't become a proficient speaker of it. Dr. Adams: Well , we can become fluent speakers in a matter of a few minutes here and there. We should follow a regular course of study and remember that there is a difference between native fluency and proficiency in a language. I propose the latter.Talk show host: What are the basic keys you suggest ?Dr.Adams: People must organize their study by setting realistic and attainable goals Some people think they can learn the language in 30 days and become discouraged when they can’t.. Small steps are the key. Learning five new words a day and learning to use them actively is far better than learning 30 and forgetting them the next day.Talk show host: Um-hum. You mentioned individual learning styles. Can you explain what you mean by learning style?Dr.Adams: Sure .People have different ways of learning .Some are visual learners who prefer to see models of the patterns they are expected to learn. Other are auditory learners who favor hearing instructions over reading them.. Our preferences are determined by factors such as personality ,culture, and past experiences.Talk Show Host: What is your learning style?Dr. Adams: I learn by doing.Talk show host: What do you mean by that?Dr.Adams:I know it might sound unusual, but moving around while trying to learn helps me.While I cut up tomatoes and onions for my breakfast in the morning ,I might recite aloud vocabulary to the rhythm of the knife .Talk show host : What is my learning style?Dr.Adams : You're going to have to read my book to find that out.Talk show host : Okay Thank for joining us.Dr.Adams: My pleasure.Exercise 11 C2 C3 A4 BExercise 2。

新编大学英语视听说教程3答案

新编大学英语视听说教程3答案

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being aware Exercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species5) oxygen 6) economic 7) conservation 8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa¥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ¥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy with Section II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particular Exercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train 13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking8. convenient9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5,7,1,4,6,3,2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic 11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slower Exercise 21. T2. F3. F4. T5.T6.F7. T8. F Listening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel:musicalBranford Marsalis: brilliant, humorousYoussou N’Dour:not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. T Exercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying 10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. T Exercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days8. give up9. stop trying 10. encounter risks 11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious 16. angel 17. grave 18. nights 19. days 20. taste。

  1. 1、下载文档前请自行甄别文档内容的完整性,平台不提供额外的编辑、内容补充、找答案等附加服务。
  2. 2、"仅部分预览"的文档,不可在线预览部分如存在完整性等问题,可反馈申请退款(可完整预览的文档不适用该条件!)。
  3. 3、如文档侵犯您的权益,请联系客服反馈,我们会尽快为您处理(人工客服工作时间:9:00-18:30)。

新编大学英语视听说教程第三册答案Keys to the texts of book3Unit OnePart OneExercise 21. Mike C2. Sam E3. .Ted D 4 Simon A 5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfecti oni st; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListe ning IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5」ook straight in the eye 6. ope nly7. look at my feet 8. shy and sile ntListe ning IIExercise 11.se nsitive; cari ng2. good friend 3」ife; people 4」eav ing ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skati ng2. chemistry3.outgo in g;bright; funny 4moody; self-ce ntered 5.wavy blond; medium size 6. runn er-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11.42.collogues3.teacher4. Susa n5. BarbaraExercise 221. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs.Duke creativeExercise 21. favourite way to relax2. how to divide3. bad unripe4. stiff sore5. fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21. flattering2.critical3.popular4. reserved5.E nglish Exercise 31. understand the Scots' English2. the friendliest3. most hospitable4. much nicer5. English courtesy6. no views on the matter/ no comments Part Four Test ing yourselfSecti on II.upset 2. sen sible 3. lecture 4. calm 5. stre ngth 6. la nded7. wavi ng 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworki ng3. efficie nt4. private5. armyofficer 6.help 7. fond 8. i ndepe ndent 9. shy 10. fiftee nUnit TwoPart OneExercise 21. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. man age to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListe ning I1 B 2.B 3.A 4. B 5. CExercise 1Exercise 21 T 2. F 3.T 4. T 5. F 6. TListe ning IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListe ning IIIExercise 1I. stayed around 2. mouse catcher 3. rats and mice 4. got a paw 5. weak and thi n6. make a woode n paw7. faste ned it8. grow sleek and fat 9man aged10. peered out cautiouslyII. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.d1 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. aExercise 21 F 2. F 3.T4. T 5. FPart Four Test ing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSecti on II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSecti on HI The lege nd of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelio n7.cowboys8. camera9. hero 10.adve nturesUnit ThreePart OneExercise 21.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListe ning IExercise 11.b2. C3. d4. aExercise 2 1 F 2. T 3.F 4. T 5. F 6. TListe ning IIExercise 21.30'2.male3. 1.90 4」ong ; wavy 5. heavily built 6.light red sweater 7. beardExercise 1Liste ning IIIExercise 11. b2. C3.d4. aExercise 2(145.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. specie:5.oxygen6.econimic development7. conservation8. valuable in come9. aware ness 10. slow dow nExercise 21 T 2. F 3.F 4.TPractice TwoExercise 1 1. F 2. F 3. T 4. TExercise 21.south America; pet food; eno ugh prote in; develop2.much more; Asia; Africa3.position; natural resources; gone down; steady4. continue to rise5. getting richer and richer Practice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleep ing peachfullyExercise 2(123.5.8) yesPractice FourExercisel1 b 2.c 3.a 4.cExercise 21」ove 2.together 3.mother 4. house 5.school 6. friends 7. father8.mouth 9.beach 10.callPart Four Test ing yourselfSecti on Ipla ined about2.work3. got out of4.on the ground5. shocked6. cold-blooded killi ng7. inv estigati on 8. drug deali ng 9. com mon 10. aga inst14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registrati on 11.str ong views 12. using drugs 13. too early5. rese ntme nt6. attractive7. educati on services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2〔.computer programmer puter engin eeri ng 3. intern ship 4. lecture; competition puter programming skills 6. impatient7. con structive 8. medical research 9. man ageme nt 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListe ning IExercise 1(2.345.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; importa nt and challe ngingcati on ;. promoti on; educated pers ons4.pare nts ; teachers ; ben efit; give careful thought; useful suggesti on; pers onal qualities;5.gett ing mon ey; our future happ in ess; comb in ati onListe ning IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children ' impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales man ager2. salary3.sales commissi on4. a car5. travel around in6. experie nces7. uni versity 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreig n visitors ; a sec ond foreig n Ian guage Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12. sensitive; extroverted 2.kids3.doing a good job4. toleranee level5. patie ntExercise 21 T 2. F 3T 4. F 5. TPart Four Test ing yourselfSecti on I1.100 million2. 35 to 403. 7 to 84. office workers and many professio nals5.8:00 ; to 4:006. eight-hour shifts7.M on day; Thursday ; Saturdays ; Sun days8. choose their own work ing hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long dista nces2. look in to it3. five times4.i ndividual; group5. sex-specific;; males; females; stra ngers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagg ing10. f eedi ng; every directi onPart TwoListe ning IExercise 11. plays; real people; real life; emotional problem; loyalty 2 public speech; make themselves taller; political ; one-sided3. soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListe ning IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4. preve nts;from achiev ing5. an xiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler 'checks; credit cardsPractice TwoExercise 1(235) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native Ianguages2. two3. more4. of their choice 5 Spanish 6. Indian 'Spanish 7. English;8. Germa n 9. FrenchPractice ThreeExercise 11. lear ner; teacher; curriculum2. aptitude; expectati ons; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting 3 determ in ed; pers on ality .culture 4. unu sual ; recite aloudPart Four Test ing yourselfSecti on I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.i nhabitSection II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。

相关文档
最新文档