新编大学英语视听说教程3(浙江大学版)听力标准答案

合集下载

新编大学英语视听说第三版第三册第三单元参考答案

Listening 4 1. Poverty crime 2. Drift better work pay 3. Resentment 4. Attractive education services 5. A more positive attitude
Part 4 Further Listening
Listening 1 1. FTFT 2. 1) South America, Pet food, enough protein
2) Much more asia Africa 3) Position natural resources gone down 4) continued to rise 5) getting richer and richer
de) The first few seconds
2) So thin 3) Beings from another 4) Focused on 5) Looked directly at 6) All around 7) Until now 8) Despair, grief and disgust 9) Started crying 10) Who was sleeping peacefully 2. 1-2-4-5-8
5) school 10) call
Listening 4 1. 1) stories 2) music 3) next door
5) secretary 6) fights 2. celia 1, 2, 4
Sarah 2, 4 Jack 1, 4 Tom 1, 2, 3
4) in love with
Part 2 1. 1-D 2-C 3-B 4-E 5-A 2. TFFTT TTTFF

【精品】新编大学英语第三版视听说3听力答案(Unit1-Unit6)

Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问，应选C，请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √　2×3×4√Jack 1 √　4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11．FTFT2．South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1）import from abroad 2）sales manager 3）salary 4）sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√Ｃ×D√Ｅ×F√G×H√I√Ｊ2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√Ｂ×C√D√Ｅ×F√Ｇ×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1：Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2：1．1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√　5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1）a.whales and dolphinsb.birdsc. tigers2）a. meat oilb.handbags shoesc.furd.ivory2.TFTT。

大学英语视听说教程3 听力答案

Unit 1 PersonalityPart 1 Listening, Understanding and SpeakingListening 11.FFTTFT2.1) outside world 2) at home 3)wave hello 4)bow 5)look straightinto the eyes 6)openly 7)look at my feet 8)shy and silent Listening 21. 1.sensitive independent2.good friend3.life people4.learning being aware2. BCADBListening 31. 1.ice-skating2. chemistry3.outgoing,bright,funny4.self-centered5.blond medium height6.runner-up2. TFTFFListening 41.1.Four2.Colleagues3.Teacher/Teaching4. Susan5. To go onholiday2.Paul DEJSusan BFMaria CHPeter AGIPart 2 Viewing, Understanding and Speaking1.CEDAB2.1) avoid confrontation 2) generally likable3) hide those traits 4) affectionate kind nature 5)stubbornness 6)worst reputation 7)revengeful and destructive 8)entertaining 9) tough and determined 10)intuition and protective nature 11)perfectionists 12) draw attentionPart 3 Video appreciation and Singing for Fun1.1. The lunar calendar2.Two trines3.Four trines2.1) who is very good with money2) who is easily angered3) display the utmost amount of energy4) longest life and good fortune5) with quick wit6) great common sense7) inspires leadership in others8) seductive and charming8)deep-thinking and very talented10) interesting and brave3. The tiger is courageous and aggressive, but is also sensitive when it comes to loved ones. They are known for their playful personality, and they are most compatible with the horse and the dog.As a horse, you are cheerful, popular, and you love the party. You come across as a warm individual, but sometimes you could be impatient. You are independent and you are also very skilled with money.As a dog, you are charismatic and a natural born leader. However, you could sometimes be a bit stubborn. You are very honest and you know how to keep a secret. When it comes to money, it doesn’t play much importance in your life.The rabbit is articulate and talented, and is known for their wonderful manners and is admired by many. The rabbit is also very trustworthy which will lead you to success in business.As a sheep, you strive for tranquility and harmony. And you are also very kind-spirited. When it comes to leadership, you could be quite timid. However, you always lead a very comfortable life.As a pig, you are very studious, and have tremendous inner-strength. You always go after your goals. You are quiet, however always well-informed. When it comes to your friends, you choose few. However, you are very trustworthy with the ones you do have.Part 4 Further Speaking and ListeningListening 11.1)upset 2)sensible 3)lecture 4)calm 5)strength 6)landed 7)swearing 8)perfectly 9)wildly 10) beeListening 21.BDAACCDCListening 31.CDEAF2.1 favorite way to relax 2. how to divide3. bad unripe3.stiff sore 5.fastening a basketball hoopListening 41.FTFFT2.1)understand the Scots’ English2) the friendliest people3) much nicer than4) English courtesy5) no views on the matterUnit 2 Myths and LegendsPart 1 Listening, Understanding and SpeakingListening 11.BABDC2.FTTFTListening 22.TFTTFFListening 31.1)stayed around 2)mouse catcher 3)rats and mice 4)got a paw 5)weak and thin 6)make a wooden paw 7)fastened it 8)grow sleek and fat 9)managed 10)peered out cautiously 11)seized it with 12) 18 miceListening 41.BDAAC2.FTTTFTFFPart 2 Viewing, Understanding and Speaking1.CEDBA2.1. in your hand used to belong to2. practicing with3.talked to each other Why not4.ask for find a way5.manage to his own love6.so foolishly jealous7.all three of them8.peacePart 3 Video appreciation and Singing for Fun2.1.invade2.shelter supply peace3.withdraw4.flag, hangedremember 5.secret, share 6.queenPart 4 Further Speaking and ListeningListening 11.BCBADA2.FFTTFListening 21. C D J2. A E G H3. B F I2. ABDCBDListening 3TFFFTFTTListening 41.associated2.railroad3. merchant4. dictionaries5.grasslands6.bring7.action8.One hundred days after his offer was made, the first herds arrived from the South.9.Soon there were at least 5,000cowboys bringing cattle up to Kansas from Texas.10. These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3 Social ProblemsPart 1 Listening, Understanding and SpeakingListening 11.BCDA2.FTFTFTListening 21.BDAD2.1)30s 2)male 3)190 4) long wavy 5)heavily built6)light red sweater 7)beardListening 31.BCAC2.1) love 2)together 3)mother 4)house 5)school6)friends 7)father 8)month 9)beach 10)callListening 41.1)stories 2)music 3)next door 4)in love with 5)secretary6)fights2.Celia: 124 Sara: 24 Jack: 14 Tom: 123Part 2 Viewing, Understanding and Speaking1.DCBEA2.TFFTTTTTFFPart 3 Video appreciation and Singing for Fun1.1. a central body transport vision2.access3. A race track4.slightly slower5.huge success2. 1.car movement cycling walking2. strategies quality of life3. visit the city4.investment design environment5. subtle design focusPart 4 Further Speaking and ListeningListening 11.FTFT2.1.South America pet food enough protein develop2. much more Asia Africa3.position natural resources gone down steady4. continued to rise5.getting richer and richerListening 21.1)the first few seconds 2)so thin 3) begins from another planet4) focused on 5) looked directly at 6)All around 7)until now8)despair, grief and disgust 9)started crying 10) who was sleeping peacefully2. 12458Listening 31)complained 2)work 3)chest 4)shocked 5) cold-blooded6)investigation 7)dealing8)He had mentioned his concern twice to the local official.9)Whenever this topic arose he always expressed strong views aboutdrugs.10) But it’s still too early to say this is related to the murder. Listening 41. 1.poverty crime2. drift better work pay3.resentment4.attractive education services5. a more positive attitudeUnit 4 Career PlanningPart 1 Listening, Understanding and SpeakingListening 11.245682.1.weaknesses2.similar abilities and interests, interest you, important andchallengingcation promotion educated persons4.parents, teachers, benefit, give careful thought. useful suggestions, personal qualities5.getting money, our future happiness, combinationListening 21.DDAB2.1)import from abroad 2)sales manager 3)salary 4)salescommission 5)travel in 6)experience 7)university 8)on a team Listening 31.1) choose their careers 2)avoid certain careers 3)differentprofessions4) impressions and prejudices 5)lawyers 6)accountants 7)scientists 8)most popular 9)least popular 10) ignorance2. TFTFTListening 41.CACBD2.1. occupation cool 2. catch, provide, fulfilling,3. media coming afteryou, make your own schedule, 4. have my pick of jobsPart 2 Viewing, Understanding and Speaking1.ABDF HIKLputer engineering puter programmer3.internship3.lecture competition puter programming skills5.impatient 7. constructive 8. medical research9. management 10. 3,600Part 3 Video appreciation and Singing for Fun1.ACDFH2.1.tremendous element of care2. where they’re from what kinds of contributions3. professional learning colleagues peers4. what makes their students tick5. relaxed care about them passionate developPart 4 Further Speaking and ListeningListening 11.1.100 million2. 35 403.seven eight4. office workers5. 8:00 4:006. eight- hour shifts7. Monday Thursday Saturday Sunday8. choose their own working hours freedom of choice happy with Listening 21.ADCADListening 3CBDCAListening 41.CABDB2.ADF, BF, ACEUnit 5 LanguagePart 1 Listening, Understanding and SpeakingListening 11.1. plays real people, real life, emotional problem, popular2. public speech, make themselves taller, political one-sided3. soft-soap, praise, kind2. FFTTTTListening 21.CAD2. 1. be understood easily2. necessary desirable,3. splendid4. prevents from achieving5. anxiety, effectListening 31.TFFFTT2.1. fairly good 2. ensure success3. natural, family relationship4. exposure5. visiting or telephoningListening 4AB2.1.Eggs Toast2.realistic, far better than, forgetting3. determined, personality, culture4. recite aloudPart 2 Viewing, Understanding and Speaking1.BACEDF2. 1. over long distances 2. look into it3. five times4. individualgroup 5 sex-specific, males, females, strangers 6. great apes7. teach, own kind 8. raised, held, look bigger9. round, tail-wagging 10. feeding, every directionPart 3 Video appreciation and Singing for Fun1.1.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.johned joined6.Siji…Siji Delaney Sinjin Delaney7.awful lawful8.spigot spiritPart 4 Further Speaking and ListeningListening 11.economic2.religious3. exist4. biologically5. 40,0006. cave7.Written8. humans were probably speaking thousands of years before that9. Even while we are reading or just thinking, we are in a sense “talking”10. Language is so much a part of human existence that we will be talking as long as we inhabit the Earth.Listening 21.DABBA2.1. permission apply for 2. application form website3.regular mail fax4. traveler’s checks credit cardsListening 31.BCE1)other native languages 2)two 3) more 4) of their choice 5)Spanish 6)Indians 7)English 8)German 9)FrenchListening 41.1. learner teacher curriculum2.curiosity, expectations, goals2. TFTFTUnit 6 Man and animalsPart 1 Listening, Understanding and SpeakingListening 11.BCDB2.TFFFTFListening 21.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACAListening 31.CABD2.1. crowding war water grass2. what is happening keep the number of horses low3. target practice where the horses were found4. gotten rid of stayListening 41.FTFTFTFF2.46Part 2 Viewing, Understanding and Speaking1.DABCC2.1)farm animals hold feed2) small pets toys 3. bury toss them out 4.real shame5. dangerous destructive bring diseases6. have point7. humanely limit 8. time, money warm place 9. isolated company 10. storm of debatePart 3 Video appreciation and Singing for Fun1.ADDBA CAB2.1.female collectively 2.not a moment3. infinite care4. picks up left to right5. struck smarter6. salt water lake, dock7. self-ware, non-human intelligencebelong in captivityPart 4 Further Speaking and ListeningListening 11.145672. ACCADListening 21.CBDDA2.257Listening 31.CADBB2.1. family holiday 2. 7-foot 18 stones3. stroking adjusting hisclothing 4. fractured skull, black eye, broken arm3.5. lose his love 6. cat 7. get-well cards presentsListening 41.1. a. whales and dolphins b. birds c. tigers2.a. meat oil b. handbags shoes c. fur d. ivory2.TFTT。

新编大学英语视听说教程3（浙江大学版）听力标准答案

新编大学英语视听说教程3（浙江大学版）听力标准答案Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly BExercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. T Exercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 T Practice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) English Part Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm5) strength6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C 8. BSection III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. C Exercise 21. T2. F3. T4. T5. F6. F Listening III Exercise 11) stayed around 2) mouse catcher 3)rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat9) managed10) peered out cautiously 11) seized it with 12) eighteen mice Part Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F3. T4. F5.T 6 F 7.F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. D Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7.F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction4) species5) oxygen 6) economic 7) conservation8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa￥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give carefulthought /useful suggestions / personal qualities 5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance Exercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 22. A3. C4. E5. D6. F Exercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More Listening Practice One Exercise 11. D2. A3. B4. A5. B Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cards Practice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.T Exercise 31. other native languages2. two4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist4. cave5. moon6. birth7. records8.agree9. by10. sense11. ourselves 12. inhabit Section II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. A Exercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debate Part Two Listening I Exercise 11. B2. C3. D4. BExercise 2。

新编大学英语视听说book3Unit4听力答案及文本

新编大学英语视听说book3Unit4听力答案及文本1Unit 4Part OneListening IFor many of you this will be your last year at university and now is the time for you to begin thinking seriously about your future careers. In order to give you as much help as possible, I have quoted a list of questions that you ought to ask yourself.First, "Have I got a clear knowledge of my abilities as well as my interests?" Be honest about your weaknesses as well as your strengths. Take a really good look at yourself and give real thought to the kind of person you are, and what kind of person you want to be.Second, "Do I know the kinds of occupations in which people like myself tend to find success and satisfaction?" Talk to people who have similar abilities and interests and who are already in the careers that interest you. You can gain some idea of what they consider to be important and challenging in those careers. Watch these people at work.Third, "Have I weighed carefully the immediate advantages against the long-term prospects offered by the jobs I am considering?" Will the occupation you select give you satisfaction in the years to come? Realize now the importance of education in all fields, technical and professional. Remember that chances of promotion are usually given to educated persons—other things being equal.Fourth, "Have I talked with my parents, my teachers and my headmaster?" Remember they have a lot of experience that you can benefit from. They can help you think about the jobs. Theycan stimulate you to give careful thought to what you really want to do, and offer useful suggestions about how you might take full advantage of your personal qualities and qualifications.Last, "How do I regard my job? Is it just a means of getting money to do the things that I want to do? Is the work important to my future happiness? Is it a combination of both?"The above questions and their answers should give you some better ideas about how you should start planning your career. Your life-long job cannot be approached in any kind of haphazard fashion. It must be considered carefully, examined from every angle, and talked over with those who know you and those who can help you in any way.Exercise 12、4、5、6、8Exercise 21. weaknesses2. similar abilities and interests / interest you/ important and challenging3. education/ promotion/ educated persons4. parents/ teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II(Here's a dialog between a woman whose job is to help people find jobs and a man looking for a job.)Woman: Look. Here's a job that might interest you.Man: What is it? Are you sure? The last job interview you sent me off to was a disaster.Woman: Well, look. It says they want a sales manager, and it looks like it's a big international company. That'd be good. Youmight get to travel.Man: What kind of company is it, though?Woman: Um, let's see. Yes, it's a textile company that seems to import from abroad. They say the salary is really good. They operate a system of paying you a basic salary and then offering you a sales commission on top of that. They say it is high. And oh, look! They give you a car to travel round in. That's not bad, is it?Man: Um, do they say anything about experience?Woman: Um, let's see. No, they want someone young with ambition and enthusiasm. Oh yes, they want graduates, so that's OK. You've been to university. Now what else? Let's see.Man: There must be some catch.Woman: No, the only thing is you have to travel, but then that's what the company car's for. Oh, and you have to be able to get on well with other people because it says you have to be good on a team.Man: Um, perhaps I'll have a closer look at that one.Exercise 11. D2. D3. A4. BExercise 21. import from abroad2. sales manager3. salary4. sales commission5. travel in6. experience7. university8. on a teamListening IIIInterviewer: Some people feel that their jobs are misunderstood by others. Is that very common?Sociologist: Oh, absolutely. Most jobs or professions have an image or stereotype attached to them, and some of these are not realistic. The serious point is that young people choose their careers based on these false images, and they may even avoid certain careers which have a negative image. This can cause problems for the economy.Interviewer: Is there evidence of this problem?Sociologist: Yes, there was a recent survey of children's attitudes to different professions.Interviewer: How was this done? Children don't know much about jobs and professions.Sociologist: True. What the investigators wanted to get was children's impressions and prejudices. They gave the children twelve pairs of statements, one of the pair positive, and the other negative. Children were asked to say which of the statements was "most true" for each profession.Interviewer: For example?Sociologist: Well, for example, "Such and such a person is likely to be boring or interesting company."Interviewer: I see. What professions did they ask about?Sociologist: The list is long, but it included lawyers, economists, accountants, sales representatives, scientists and engineers.Interviewer: And the results?Sociologist: Well, they are striking, especially for engineerswho came out much worse than one might expect. About 90 percent of the children thought that engineering was a "dirty job", of "low status", and the engineer was more likely to take orders than to give them. The only other person they thought more likely to lose his job was the sales representative. But, there were good points too. Engineering was seen to be "interesting, well-paid work".Interviewer: Hmm, not a rosy picture.Sociologist: No, but it got better when children were asked what they thought of the engineer as a person. Most of them chose positive comments, but most thought the engineer was likely to be badly dressed.Interviewer: What about other professions? What were the most popular?Sociologist: Oh, the lawyers by far. Next came accountants and scientists as well as economists. The engineers and sales representatives were the least popular.Interviewer: Sounds like a sign of the times.Sociologist: Yes, but I think the most serious implication was the children's apparent ignorance of the importance of the engineer's role in society.Exercise 11. choose their careers2. avoid certain careers3.different professions4. impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. F3. T4. F5. TListening IVMegan: Tim, if you could pick any occupation in the world, what do you think would be a cool one?Tim: Well, truth be told, i think it would be pretty awesome to be a commercial fisherman. Megan: Fisherman! Why would you want to be a fisherman?Tim: Believe it or not, i’m really fascinated by the ocean. I like spending time in the ocean and I think if you go out on those boats and get away from the land, you really get in touch with the sea.Megan: Is it dangerous, though?Tim: Oh, it can be dangerous, for sure. You can get caught in storms. It can be rough sometimes.Megan: Do you get paid a lot of money?Tim: Not so much, but that is not necessarily vital. You know, you can work with nature. You can catch healthful food, provide for yourself, and I think that’s really fulfilling. How about you , Megan? What do you think would be a cool job?Megan: I think I would like to be a writer.Tim: Why is t hat? Lots of writers don’t succeed in making much of a living.Megan:Well, being a movie star would be exciting too, or a rock star, but the fame is overwhelming—too many peoplealways want to talk to you or want your autograph. I think as a writer, you are doing something you love without all that pressure or the media coming after you, and you can sort of make your own workk schedule and do it where you like. You can write in the countryside in a cabin, or you can write in the city wherever you please. So, I think it is a very flexible, rewarding job.Tim: Yeah, you’ve got to have the aptitude for it, though. Do you think you have what it takes?Megan: No, not yet. I’m a terrible writer. But anyway, if I could have my pick of jobs, I’d like to be a writer.Exercise 11. C2. A3. C4. B5. DExercise 21. occupation, cool2. catch, provide, fulfilling3. media coming after you, making your own work schedule4. have my pick of jobsPart 4Further ListeningListening IThere are at least 100 million workers in the Unites States. Most of them are on the job 35 to 40 hours a week. Their typical day includes seven to eight hours of work. Usually, they have a 15-minute coffee break in the morning and in the afternoon. But work schedules vary from job to job.White-collar workers—office workers and manyprofessionals—usually have "nine to five" jobs. They begin at 9:00 a.m. and finish at 5:00 p.m. Monday through Friday. "Blue-collar" workers—mechanics, electricians, and laborers—often work from 8:00 a.m. to 4:00 p.m. In many factories, blue-collar workers come to work in eight-hour shifts. Typically, these shifts start at 8:00 a.m., 4:00 p.m., and midnight. Finally, sales people and managers in retail stores work on Monday and Thursday nights, when the stores are open. Many retail workers also work on Saturdays, and some work on Sundays.These are the normal schedules for most American workers. However, many businesses now use a new system called "flex-time scheduling". Under this system, the employees choose their own working hours. Some people work from 8:00 to 4:00 five days a week. Some work from 9:00 to 5:00. Other people work 10 or 12 hours a day four days a week. Employees and managers are both happy with the system. The employees like the freedom of choice, so they work hard. The managers, of course, like the hard-working employees.What, then, is a typical work schedule? It depends on the job—and on the workers.Exercise:1. 100 million2. 35 to 403. 7 to 84. office workers, many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday ,Thursday, Saturdays ,Sundays8.choose their own working hours, freedom of choice , happy withListening IIMan: How long have you worked for AM-ADMEL, Gill?Woman: Only for a year. It's May now, isn't it? Yes, I joined last August in fact.Man: August in 1996.Woman: Yes.Man: What did you do before that?Woman: I used to work for a travel agency in London.Man: It was interesting, wasn't it?Woman: Not really. It was just secretarial work, rather like this job. And it wasn't too well-paid. But I took a secretarial course when I left school and I couldn't think what else to do.Man: So you went straight from school into a secretarial course, didn't you?Woman: Well, not quite. I left school when I was 16, in 1989, I think it was. And then I went to work in a hotel in Austria for a year, to learn some German.Man: Austria? Why Austria?Woman: I don't know really. Well, we used to go there on holiday quite often when we were younger, and, well, I like Austria actually. Anyway then I went back and did the secretarial course. That was a year's course.Man: And then you got the job at the travel agency I suppose.Woman: Yeah, that's right. That was in 1991.Man: So you were there for five years!Woman: Yes, it's awful, isn't it? Actually, I'm thinking of giving it all up to become a nurse.Man: Really?Woman: Well, I worked in a hospital in Twickenham during my last year at school. Just cleaning and helping to make bedsand so on. It was part of our Practical Careers training.Man: And you liked it?Woman: Yes, it was interesting.Exercise1. A2. D3. C4. A5. DListening IIIMan: Well, now then, one thing I'd like to ask is, er, exactly why you applied for the job. I mean, just looking at your application form, you're actually over-qualified...Woman: Yes, I thought you might ask that. Um, the thing is, in my present job, although I'm actually in charge of a small team and I have a lot of responsibility, it's largely a desk job with a lot of paperwork...Man: And you're not too keen on being stuck in an office all day?Woman: To be honest, no, I'm not. I much prefer being out on site where I can supervise things, and deal with problems as they occur. And this job should give me the kind of contact with other engineers, architects, builders and so on.Man: Mmm. You'd certainly have to do quite a lot of traveling in the local area, you know, visiting different sites. You do realize, though, that the starting salary isn't as good as the salary in your present job?Woman: Yes, I realize that, but um, it does say in the job advertisement that the promotion prospects are very good.Man: That's true, and er, as this is a new project that we'reworking on, we think there'll be a very good chance of fairly quick promotion, depending on performance, that is...Woman: Yes, of course. Well, you see, I've got very little chance of promotion in my present job.I mean it's a very small company and there's nowhere really for me to go; that's why I'm looking around for somewhere else.Exercise1. C2. B3. D4. C5. AListening IVDavid: Hi! You're listening to Radio Southwest, the best in the southwest for music andup-to-the-minute news. Sue's here. Hello, Sue.Sue: Hello, David.David: And we've got the Jobspot for you today. So, if you're looking for a new job, this could be the spot for you. So, let's have a look, and see what we've got today.Sue: Well, the first one we've got is a cook. That's in a large, busy restaurant, so it's very useful to have had experience in cooking. Must be a high school graduate and the pay is $12 an hour. So that's not bad, is it? The hours are good too. That's Monday to Friday, 3:00 p.m. till 6:00 p.m.David: Great. Thanks, Sue. So that's a cook. Now, how do you fancy working out of doors? How do you fancy being a gardener? So as long as you're fit and strong, and at least 16 years old, that'll suit you. The pay is $8 an hour. And the hours, Tuesday to Saturday, 8:30 a.m. to 5:00 p.m., you have to work on Sundayonce a month, but on Monday the Garden Center's closed. Now, the sort of work you'd be doing is potting, watering, things like that. So, how about applying for that? Pay, $8 an hour. Sue, what else have you got?Sue: Right, Dave. Well, from outdoors to indoors. We've got a word processor operator job here. This job might suit a woman with school-age children, because the hours are only 15 hours a week. It's a small, friendly office, and they require a high school graduate with two years' experience operating a computer. Pay is $9 per hour. So, there you go. That's a nice job in an office. If you fancy any of those jobs, give us a ring here on Jobspot at Radio Southwest. And now back to the music.Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACE。

新编大学英语视听说book3Unit6听力答案与文本

新编大学英语视听说 book3 Unit 6听力答案与文本1Unit 6Part 1Listening IWoman: Why do you think people are afraid of tarantulasMan: Well, I guess it's because people are afraid of all spiders, and tarantulas happen to be the biggest of all the spiders. And maybe it's also because some spiders really are very poisonous. In California, for example—in most of the garages in California—you get black widows, which are quite small but certainly more dangerous than tarantulas. Woman: But personally you aren't afraid of tarantulasMan: Well, I shouldn't be frightened of tarantulas, simply because I know that they aren't really dangerous —all they can do is give you a small bite, but it's not poisonous. And yet I must say I don't like to pick them up. But you see, some people keep pet mice and pet rabbits and, well, they can give you a much worse bitethan a tarantula ever could. And yet people aren't frightened of them.Woman: Why do you think people are frightened of spidersMan: I don't know—it's very strange. People are frightened of spiders and they are frightened of snakes, and, well, obviously some spiders and some snakes really are poisonous. But most snakes are harmless, and it's really strange that people are so frightened of spiders because it's quite difficult to find a spider that's really dangerous.Exercise 11. B2. C3. D4. B Exercise 21. T2. F3. F4. FListening IIShop Assistant: Good afternoon, madam. Can I help youCustomer: Yes. I'm looking for a pet for my son. Can you suggest anythingShop Assistant: What kind of pet does he want A traditional pet, a cat...or a dog Or something unusual Customer: Well, he'd like a snake or a crocodile,but he isn't going to get one. Shop Assistant: We've got a nice Alsatian at the moment.Customer: An Alsatian Did you say \They're very big and savage.Shop Assistant: Oh, no, madam. They aren't as savage as some dogs. Customer: ReallyShop Assistant: Oh, yes. Last week we had a small dog. It was only as big as your handbag, but it was as savage as a tiger—it bit me three times! Customer: Perhaps not a dog, then. Shop Assistant: How about a catCustomer: A cat Hmm...they aren't as friendly as dogs, are theyShop Assistant: No, but they don't eat as much as dogs either. And they're very clean. They wash themselves every day. Customer: Hmm...Shop Assistant: Or how about a bird A parrot or a budgie We have both. Customer: Which do you rexxmend Shop Assistant: Well, budgies aren't as easy to train and they never speak as well as parrots. Customer: Yes, but budgies don't need as much space as parrots, do theyShop Assistant: That's true. Budgies are very popular because they are so easy to keep. Customer: Yes...but they're a bit noisy, aren't they I want a quiet pet.Shop Assistant: A quiet pet Well, how about a goldfish There's nothing as quiet as a goldfish.Exercise 11. snake, crocodile2. parrot, budgie3. quiet4. goldfish Exercise 21. A2. D3. A4. C5. AListening IIIOver 450 wild horses have been killed in Nevada. The land they were on belonged to thegovernment. Some people say it is worse than when all the buffaloes were killed. Many of the horses were shot while running.Wild horses are protected by law. 28 thousand wild horses share the land with six million cattle. Cattlemen say the horses are crowding the cattle out. It is said that there is a war going on. Both the cattle and the horses need the water and grass that is on the land.The president of the Nevada cattleman group also helps to protect the horses. He says that he does not like what is happening to the horses. He does want the government to help keep the number of horses low.Some people think the Navy used the wild horses for target practice. Pilots flew over the area where the horses were found. The Navy said that they did not let their pilots do that.The horses were found far from the nearest road. The killings happened over a large area. It has been happening for the last two years.Some people think that the horses should be gotten rid of. Others think that they should stay. In the meantime, the police will try to figure out who killed the horses. Questions:animal has been killed in Nevada recently is the number of the animals killed long has the killing lasted did the killingExercise 11. C2. A3. BExercise 21. crowding , war, water, grass2. what ishappening, keep the number of horses low 3. target practice, where the horses were found 4. gotten rid of , stayListening IVNarrator: I'm going to tell you about an extraordinary thing that happened the day before yesterday, about eight o'clock at night, a young woman approached the box office of the best movie theater in the city. She had with her an enormous dog with a beautifully groomed coat. She bought two tickets and went toward the door, followed by her dog. The manager of the theater spoke to her...Manager: I'm sorry, Miss, but dogs aren't allowed in this theater. Girl: But I have a ticket for him.Manager: I'm very sorry, but animals aren't permitted.Girl: You don't understand. This is a special case. My dog is so well trained and so intelligent that he's almost human.Manager: I see that you have an exceptional animal, but...Girl: I promise you that if there is any problemwe'll leave the theater immediately. I assure you that this dog isn't like any other dog you've ever seen.Manager: Well, all right. I'll let you go in, since the theater is almost empty tonight. Nevertheless, your dog will have to behave himself, or you will have to leave.Narrator: About two hours later, and now the people are leaving the theater. The manager sees the girl with her dog.Manager: I congratulate you. You are right; your dog behaved very well. I've been watching him, and it's amazing how quiet he was.Girl: I told you that he's well trained and very intelligent.Manager: He certainly is. It even seemed as if he was enjoying the movie.Girl: Oh, he did enjoy it. He liked the film very much. However, he liked the book much better. Exercise 11. F2. T3. F4. T 8. F Exercise 2 4 6Part 2Exercise 11. D2. A3. B4. C5. C6. A Exercise 21. farm animals, hold, feed2. small pets, toys3. bury, toss them out4. real shame5. dangerous, destructive, bring diseases6. havea point 7. humanely, limit8. time, money, warm place 9. isolated, xxpany 10. storm of debatePart 3Exercise 11. A2. D3. D4. B5. A6. C7. A8. B Exercise 21. female, collectively2. not a moment3. infinite care up, left to right 5. struck, smarter 6. salt water lake, dock 7. self-aware, non-human intelligence, belong in captivityPart 4Further listening Listening 1Many people around the world bexxe friends with animals. Some call their pet animals byhuman names. They treat them like members of thefamily. Scientists now are proving what many pet owners already know—pets are good for your health.The Delta Society is a research center in the northwestern state of Washington. They say animals have a healthy effect on people, especially people who are sick and lonely.Several years ago, the Delta Society developed a program called \people work in pet therapy programs throughout the country. They take animals to visit people in hospitals, prisons and private homes. Dogs and cats are taken most often. But other visitors include snakes, rabbits, horses and birds. Some of the animals stay with the people forever. The dolphin also has a good effect on people. Scientists at the Dolphin Research Center in Florida introduce sick people to playful dolphins. People feed the dolphins, touch them, and ride on the dolphins' backs in the water. In this way, the animals help the patients feel better.The head of the Delta Society, Linda Hines, says one reason for the pet therapy is that animals help sick people get better. Also, she says the animals have a calming effect on people, because pets can help peopleforget their own problems.Exercise 1 1. Exercise 21. A2. C3. C4. AListening II1Unit 6Part 1Listening IWoman: Why do you think people are afraid of tarantulasMan: Well, I guess it's because people are afraid of all spiders, and tarantulas happen to be the biggest of all the spiders. And maybe it's also because some spiders really are very poisonous. In California, for example—in most of the garages in California—you get black widows, which are quite small but certainly more dangerous than tarantulas. Woman: But personally you aren't afraid of tarantulasMan: Well, I shouldn't be frightened of tarantulas, simply because I know that they aren't really dangerous —all they can do is give you a small bite, but it's not poisonous. And yet I must say I don't like to pick them up. But you see, some people keep pet mice and petrabbits and, well, they can give you a much worse bite than a tarantula ever could. And yet people aren't frightened of them.Woman: Why do you think people are frightened of spidersMan: I don't know—it's very strange. People are frightened of spiders and they are frightened of snakes, and, well, obviously some spiders and some snakes really are poisonous. But most snakes are harmless, and it's really strange that people are so frightened of spiders because it's quite difficult to find a spider that's really dangerous.Exercise 11. B2. C3. D4. B Exercise 21. T2. F3. F4. FListening IIShop Assistant: Good afternoon, madam. Can I help youCustomer: Yes. I'm looking for a pet for my son. Can you suggest anythingShop Assistant: What kind of pet does he want A traditional pet, a cat...or a dog Or something unusualCustomer: Well, he'd like a snake or a crocodile, but he isn't going to get one. Shop Assistant: We've got a nice Alsatian at the moment.Customer: An Alsatian Did you say \They're very big and savage.Shop Assistant: Oh, no, madam. They aren't as savage as some dogs. Customer: ReallyShop Assistant: Oh, yes. Last week we had a small dog. It was only as big as your handbag, but it was as savage as a tiger—it bit me three times! Customer: Perhaps not a dog, then. Shop Assistant: How about a catCustomer: A cat Hmm...they aren't as friendly as dogs, are theyShop Assistant: No, but they don't eat as much as dogs either. And they're very clean. They wash themselves every day. Customer: Hmm...Shop Assistant: Or how about a bird A parrot or a budgie We have both. Customer: Which do you rexxmend Shop Assistant: Well, budgies aren't as easy to train and they never speak as well as parrots. Customer: Yes, but budgies don't need as much space asparrots, do theyShop Assistant: That's true. Budgies are very popular because they are so easy to keep. Customer: Yes...but they're a bit noisy, aren't they I want a quiet pet.Shop Assistant: A quiet pet Well, how about a goldfish There's nothing as quiet as a goldfish.Exercise 11. snake, crocodile2. parrot, budgie3. quiet4. goldfish Exercise 21. A2. D3. A4. C5. AListening IIIOver 450 wild horses have been killed in Nevada. The land they were on belonged to thegovernment. Some people say it is worse than when all the buffaloes were killed. Many of the horses were shot while running.Wild horses are protected by law. 28 thousand wild horses share the land with six million cattle. Cattlemen say the horses are crowding the cattle out. It is said that there is a war going on. Both the cattle and the horses need the water and grass that is on theland.The president of the Nevada cattleman group also helps to protect the horses. He says that he does not like what is happening to the horses. He does want the government to help keep the number of horses low.Some people think the Navy used the wild horses for target practice. Pilots flew over the area where the horses were found. The Navy said that they did not let their pilots do that.The horses were found far from the nearest road. The killings happened over a large area. It has been happening for the last two years.Some people think that the horses should be gotten rid of. Others think that they should stay. In the meantime, the police will try to figure out who killed the horses. Questions:animal has been killed in Nevada recently is the number of the animals killed long has the killing lasted did the killingExercise 11. C2. A3. BExercise 21. crowding , war, water, grass2. what is happening, keep the number of horses low3. target practice, where the horses were found4. gotten rid of , stayListening IVNarrator: I'm going to tell you about an extraordinary thing that happened the day before yesterday, about eight o'clock at night, a young woman approached the box office of the best movie theater in the city. She had with her an enormous dog with a beautifully groomed coat. She bought two tickets and went toward the door, followed by her dog. The manager of the theater spoke to her...Manager: I'm sorry, Miss, but dogs aren't allowed in this theater. Girl: But I have a ticket for him.Manager: I'm very sorry, but animals aren't permitted.Girl: You don't understand. This is a special case. My dog is so well trained and so intelligent that he's almost human.Manager: I see that you have an exceptional animal, but...Girl: I promise you that if there is any problem we'll leave the theater immediately. I assure you that this dog isn't like any other dog you've ever seen.Manager: Well, all right. I'll let you go in, since the theater is almost empty tonight. Nevertheless, your dog will have to behave himself, or you will have to leave.Narrator: About two hours later, and now the people are leaving the theater. The manager sees the girl with her dog.Manager: I congratulate you. You are right; your dog behaved very well. I've been watching him, and it's amazing how quiet he was.Girl: I told you that he's well trained and very intelligent.Manager: He certainly is. It even seemed as if he was enjoying the movie.Girl: Oh, he did enjoy it. He liked the film very much. However, he liked the book much better. Exercise 11. F2. T3. F4. T 8. F Exercise 2 4 6Part 2Exercise 11. D2. A3. B4. C5. C6. A Exercise 21. farm animals, hold, feed2. small pets, toys3. bury, toss them out4. real shame5. dangerous, destructive, bring diseases6. havea point 7. humanely, limit8. time, money, warm place 9. isolated, xxpany 10. storm of debatePart 3Exercise 11. A2. D3. D4. B5. A6. C7. A8. B Exercise 21. female, collectively2. not a moment3. infinite care up, left to right 5. struck, smarter 6. salt water lake, dock 7. self-aware, non-human intelligence, belong in captivityPart 4Further listening Listening 1Many people around the world bexxe friends with animals. Some call their pet animals byhuman names. They treat them like members of the family. Scientists now are proving what many pet owners already know—pets are good for your health.The Delta Society is a research center in the northwestern state of Washington. They say animals have a healthy effect on people, especially people who are sick and lonely.Several years ago, the Delta Society developed a program called \people work in pet therapy programs throughout the country. They take animals to visit people in hospitals, prisons and private homes. Dogs and cats are taken most often. But other visitors include snakes, rabbits, horses and birds. Some of the animals stay with the people forever. The dolphin also has a good effect on people. Scientists at the Dolphin Research Center in Florida introduce sick people to playful dolphins. People feed the dolphins, touch them, and ride on the dolphins' backs in the water. In this way, the animals help the patients feel better.The head of the Delta Society, Linda Hines, says one reason for the pet therapy is that animals help sick people get better. Also, she says the animals have acalming effect on people, because pets can help people forget their own problems.Exercise 1 1. Exercise 21. A2. C3. C4. AListening II。

新编大学英语视听说教程第三册标准答案

Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5.travel around in 6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice Two(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。

新编大学英语视听说教程第三册听力答案

Keys to the texts of book3Unit sixPart OneExercise 2 :1. d2. a3. b4.c5. c6. aExercise 31. farm animals; hold; feed2. small pets; toys3. buy; toss them out4. real shame5. dangerous; destructive ; bring diseases6. have a points7. humanely; limit8. time; money; warm place9. isolated; company 10. storm of debatePart TwoListening IExercise 11. b2. c3.d4. bExercise 21 T 2. F 3.F 4. F 5. T 6. TListening IIExercise 11.Her son.2. snake; crocodile3.quiet4.picky/particular Exercise 21. big2. dogs3.tiger4. bit5. cat6. friendly 6. eat 8. clear 9.wash 10.space 11. noisy 12. train 13. speak 14.keep 15. quietPart ThreePractice oneExercise 1(1,4,5,6,7,) yesExercise 21 a 2.b 3.c 4.a 5. dPractice TwoExercise 1(1,3)yesExercise 21. for free2.small donation3. 204. hundreds5. eat little6.50 7. animal shots 8. numerous shots 9. diseasesPractice ThreeExercise 11.c2.b3.d4.c5.aExercise 2(2,5.6.7) yesPractice FourExercise11 c 2.c 3. a 4.b 5. dExercise 21.crowding water; grass;2. what is happening; low3.targetpractice; over the area4. gotten rid of; stayPart Four Testing yourselfSection I1.f2. t3. f4. t5. f6. t7. t 8. f 9. f 10. tSection II1. a2. c3. d4. b5. b6. bSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5000 12. embarrassed 13. advertise the furs 14. export bans 15. importation 16.turtleKeys to the texts of book3Unit sevenPart OneExercise 2 :1. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery ;historic interest3. Summer ; too cold4. long history ; vast territory5. feed the monckys6. as many places as possible.7. you name it8.. host city ;ancient civilization; modern architecture9. city wall; treat yourselves 10.express train Part TwoListening IExercise 11 c 2. b 3. b 4. c 5. d 6. aExercise 21. SN 862 17:50 on July 112. SN863 15:10 on July 14 Listening IIExercise 1(B.C.F.G.H.I) yesExercise 2Part one 1.F 2. T 3.T 4.T Part two 1.F 2.F 3T 4.F Part three1.T2.T3.T .4.T5.FPart ThreePractice oneExercise 1Advantages: ADH ; disadvantages: EExercise 21 c 2.d 3.b 4. cPractice TwoExercise 11. seedypany3.shared4. noisy5. early6. private7. booking8. convenient9. restaurant 10.bathroomsExercise 21. T2. F3. T4. T5.6. TPractice ThreeExercise 11. Fuel2. Water3. Vehicles4. ClothesExercise 21.passing lorries 6. self-sufficient2.enough water 7. car repairs3.drinking 8. cost much4.vehicle 9. sweaters5.emergency 10. European winter Practice FourExercise1a. actress Bb. actress and author A1. a2.b3.b4. a5.b6. a7. a8. b Exercise 21.T . F 3. F 4. F 5. F 6. T 7. F 8.TPart Four Testing yourselfSection I1.F2.T3.T4. T5. FSection II My history teacher1. b2. c3. c4. c5. a6. dSection III1. d2. b3.c4. d5. aKeys to the texts of book3Unit eightPart OneExercise 2 :Section A5,7,1,4,6,3,2Section B1)F H I 2)A 3) C E J 4) B D G JExercise 31.passed out; in shock2. back and forth3. knows the reason why4. no doubt; living without her5. plays a great role6. brilliant boy7. very few cases8. deny; nature9. bright or not; should; CAN 10. thicker than; genetic relationship 11. react to; not to mention 12. hard decision; involvedPart TwoListening IExercise 11 F 2. F 3. T 4. F 5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed 8. language 9. young 10. alike 11. separated 12. apart 13. career 14. interestsListening IIExercise 11.b2.d3. a4. dExercise 2(1,4,6,8,10,11,12 ) yesPart ThreePractice oneExercise 1(3,6,9) yesExercise 21. six2. four3.1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice TwoExercise 11. 19212. fit the child3. ordinary schools4. adult conception5. BarbaraExercise 21. good being2.wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars 10. scholars 11. street cleanersPractice ThreeExercise 11. c2.b3. c4. bExercise 21 F 2. F 3. T 4. F 5. FPractice FourExercise11 a 2. c 3. d 4. aExercise 21.F2. T3.T4. T5.T6. TPart Four Testing yourselfSection I1.talent2.dancing3.creative4. early5. physical6. energy7. less8. curiosity9. particularly 10. cause 11. fundamental 12. meaning 13. superior 14. fluently 15. read 16. exceptional 17 preparation 18. fullySection II1.F2. T3. F4. F5. T6. F7. F8. TSection III1. c2. a3. c4. b5. dKeys to the texts of book3Unit NinePart OneExercise 2 :1. c2. c E3. .c4. w5. w 6 c 7. c 8. c 9.c 10. w 11. w 12. w 13. c 14. w 15. w 16. c 17. w 18. wExercise 31.prefer; old- fashioned2. as old as3. account for4.own; play; earn a living5. very proud of6. had the chance7. hills; small bridges; singing of birds8. full of energy9. holes; buttons; precise; notes 10.indirectly; individualistic 11. places great importance on 12. a universal languagePart TwoListening IExercise 11 restaurants, airports supermarkets; banks 2. attitudes; in the right mood ; a better feeling; the people around him; happy; work better 3. world war II 4. happy; calm ; a machine; kinds of music ; different times; faster ; slowerExercise 21. T2. F3.F4.T5.T6. F7. T8.FListening IIExercise 11.eases their minds; operations2. classical; instrumental Jazz;folk music 3. reduce tension; 50 male doctors; Mathematics ; 1. quickly 2. calmly 3. chosen for them 4. no music 5. the worst sleepyExercise 21. T2. F3.T4. F5. FPart ThreePractice oneExercise 11. b 19622.d 19633.a 19644. c 1970Exercise 21. their own style2. the nature3. sounds; experimented4. songs; records5. films ; awardsPractice TwoExercise 11. (1) (2) (3)2.(2) (1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the string5. manages the bowExercise 3.1. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice ThreeExercise 11. T2. T3. T4. F5. F6. F7. F8. TExercise 2。

新编大学英语视听说教程3听力标准答案

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly BExercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. T Exercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 T Practice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection II1. B2. B3. D4. B5. D6. A7. C 8. BSection III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. C Exercise 21. T2. F3. T4. T5. F6. F Listening III Exercise 11) stayed around 2) mouse catcher 3)rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7.F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. D Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7.F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction4) species5) oxygen 6) economic 7) conservation8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa￥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. F Exercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. B Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.T Exercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by10. sense11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. A Exercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debate Part TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.D Exercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory10. reduced11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. A Exercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages E Exercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathroomsExercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7)A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. D Section III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.T Part Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16.C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makesthe notes4. on the strings5. manages the bow Exercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. TExercise 2Bruce Springsteen: communicative, direct, exciting, simplerSting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorous Youssou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damaged Exercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. A Section II 1. C 2. B 3. D 4.A 5. B Section III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black11. white 12. shaking 13. wet 14. sweet15. delicious16. angel 17. grave 18. nights 19. days 20. taste。

新编大学英语视听说第3册听力原文和答案

新编大学英语视听说第3册听力原文和答案新编大学英语视听说第3册听力原文和答案Interviewer: Angela, you were born in Korea but you've been livingin Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I havetwo personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian. Interviewer: That sounds complicated. Could you explain what you mean?Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to whatis polite? Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person? Angela: Yes, but sometimes I don't know who I am.I am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others aregoing through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself.I don't like people doing things for me, or helping me, or giving me things.It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything. I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask. I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. Itmakes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Tom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing,bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different. Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in theMiss California Beauty Pageant two years ago. Well, you're probably not interested. Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!David: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile...He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot ofquestions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite agrown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and Ithink that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it?Have a good holiday, won't you?Barbara: Thanks.David: Bye.1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chairhe wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then youcan sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room inthe school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?A number of visitors to the UK, who had traveled throughout theBritish Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Somewere very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularlythe English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found Northcountry people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!" A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. Hehadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself. Statements:1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitora lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors.One day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was moresensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at thefly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not.I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee. Tom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. T aylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything. Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test. Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!(S1 = the first speaker; S2 = the second speaker; S3 = the third speaker; S4 = the fourth speaker)S1: In this week's edition of Up with People we went out into the streets andinterviewed a number of people. We asked a question they just didn't expect. Weasked them to be self-critical...to ask themselves exactly whatthey thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard.S2: Well...I...I don't know really...it's not the sort of question you ask yourself directly. I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretaryby the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street... Well...then I see someone a bit different. Yes...I'm different in my private life. And that's probably my mainfault I should say... I suppose I'm not coherent in my behavior. Myoffice is always in order...but my flat! Well...you'd have to see it to believe it.S3: Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4: Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven.I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.Mike: Hey, guys. Come and look. I've found an interesting Web siteon star signs. (The others come close to the computer and look at thestar signs on the screen.)Ted: Hey, that's interesting! What's your sign, Sam?Sam: I'm a Scorpio. What's yours, Ted?Ted: I have no idea. I've never really thought about that. Let's have a look. I was born on September 5. Oh, I'm a Virgo.Simon: And I'm a Libra.Sam: What do they say about Libra, Simon?Simon: (He reads.) You're a sociable, charming person. You go out of your way to avoid confrontation and do everything in your power to make your life an easy one. Although you're generally likeable, you can be changeable, superficial and critical. But you manage to hide thosetraits most of the time.Mike: Do you agree with that? Are you that type of person?Simon: What do you think? I think there is something in what it says.I am social and outgoing. But I am not changeable, am I? What's your sign, Mike?Mike: I'm a Taurus. Ah, what's yours, Lilly?Lilly: I'm a Cancer.Ted: Now let's look at Taurus.( He reads.) You're a patient,practical type. Goodpoints include your affectionate, kind nature, your trustworthiness and strength of character. Bad points include your possessiveness, self-indulgence and stubbornness. Do you think your character fits well?Mike: No, not at all. I'm not patient, and I'm not practical either.I am kind of quick-tempered and ambitious. That's definitely not me! But one thing is right: I AM stubborn.Simon: Sam, let me read yours. (He reads.) You are secretive, and sexy. You have theworst reputation in the zodiac. Scorpio has a dark side, which includes revengeful and destructive traits. Yet despite this, you can be the wittiest, kindest and most entertaining of all the signs.Sam: Oh, that can't be true! Are you sure you were reading Scorpio?Simon: Yes, of course! Look for yourself.Sam: But that's unfair! I have the worst reputation in the zodiac?!The others: (They all laugh and say.) Ha ha... Poor Sam!Sam: Who could believe such silly things! Really, I think I'm intelligent, humorous, and kind-hearted.Mike: Yes, but those are just your good traits. Don't forget about your bad ones! Sam: Come on! Oh, Lilly, we haven't looked at your sign yet. Eh, you are a Cancer, right? You want me to read yours?Lilly: No, thanks. I'm afraid you'll distort what's written there.Let me read it myself. (She reads.) To some people, you appear tough and determined, but that's just a "front" you put up to protect the real you, which is rather more sensitive and softer. You can be moody, touchy and irritable, but you make up for those negative traits with your kindness, great intuition and protective nature. That's not bad, is it?Simon: No. But what counts is not what it says, but how you really are, what you are actually like.Lilly: (She is a bit defensive.) What do you mean? What are youtrying to say aboutme?Simon: I think you are much nicer than what it describes.(Lilly smiles.)The other boys: Oh, Simon, don't sweet-talk her! We know what youare thinking. Ted: Hey, I haven't seen mine yet. Now it's my turn.Mike: Go ahead, Ted! Be our guest!Ted: It says: Virgo people like order in all things and are neat, clean and precise in their habits. Virgo people are perfectionists and they sometimes can be critical. They do not like to draw attention to themselves. Virgo people are modest, and careful about what they eat or drink.Sam: Do you have any objections to that?Ted: I think the description matches me quite well. I AM a perfectionist. I like things to be in order. Erm, I...I'm careful about what I eat and drink. But it doesn't mention my weak points.Lilly: Oh! And what are those?Ted: Well, sometimes I'm so careful I tend to waste a lot of time.I'm not very sociable, and I don't have many friends.Sam: I think everyone has some undesirable personality traits that could be improved. Don't you think we all could improve our personalities?Mike: I think we can. For example, my little sister was the youngest girl in our family. My parents loved her very much, but they spoiled her by giving her too much. She was at that time self-centered, selfish,aggressive, bad-tempered, and rude. Her personality didn'tchange any until she entered primary school. In school, she first acted as she did at home, and she couldn't make a single good friend. For a time, she was even isolated by her classmates. She complained to us, and finally understood her problem. From then on, she made every effort to get rid of her undesirable characteristics both at home and in school. Now she's in middle school and has turned into a popular girl.Lilly: In my opinion, our personalities are partly inherited and partly shaped by our home environment. As we all know, scientists have found that parents' personality traits can be seen in their children. Most children have some of their parents' personality traits.Mike: That's right. And our early home and school environment also has a big influence on the shaping of our personality. For instance,I've noticed that many children growing up in rich families may become wasteful, lazy, arrogant or cold. On the other hand, I've noticed that many children raised in poor families are hard-working, caring, sympathetic, and helpful.Sam: Does that mean you think we have to choose our parents wisely?(The others laugh.)2Mart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I hadthis good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I shouldsend her out there. It was a cold day in the fall. Well, she tookright off and away she went. But she didn't show up when it got dark. I began to worry about her. She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and seeif I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was this dog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth."There was an old man who had a daughter. He told his daughter thathe had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten themall up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen hisknife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papa invitespreachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled to the preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these."Jack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat.So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his woodenone. In no time, that cat had eighteen mice piled up in front of the mouse hole.Ken: Hey, Josh. Where did you get those comic magazines?Josh: When I went home last weekend, I found these old Superman magazines that my older brother had bought manyyears ago.Ken: You don't have time to read old comics. Why did you bring them here? Josh: In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken: Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh: When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken: How?Josh: Superman is an orphan who comes by rocket to Earth when his native planet explodes. He lands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work and consideration for others. As an adult, he migrates to a large city and defends Americans against evil.Ken: What else?Josh: Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken: But how does that relate to Superman?Josh: He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values ofhonesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken: I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh: OK.At one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs insteadof only for food. Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painfulstiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you."The spirits of the deer would run to the place where a deerhad been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If theanswer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again.Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them. When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a。

新编大学英语3视听说1~4单元听力原文与答案

Unit 1Part oneListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela:Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian. Interviewer: That sounds complicated. Could you explain what you mean? Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home. Interviewer: Do different cultures have different ideas as to what is polite? Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person? Angela: Yes, but sometimes I don't know who I am.Exercise 1 1. F 2. F 3. T 4. F 5. T 6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silent Listening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Exercise 1 1. sensitive/ caring independent / understanding 2. good friend 3. life people 4. learning being awareExercise 2 1. B 2. C 3. A 4. D 5. BPart Three More ListeningPractice oneTom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different. Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she hasa tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 1 1. ice-skating 2. chemistry 3. outgoing bright funny 4. moody self-centered 5. wavy blond medium height 6. unner-upExercise 2 1. T 2. F 3. T 4. F 5. F 6 TPractice twoDavid:Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl. David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.Exercise 1 1. Four 2. Colleagues 3. Teacher 4. Susan 5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter A G IPractice Three1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 1 1. Pedro energetic 2. Mr. Miller patient 3. Mr. Smith honest 4. Jake stubborn 5. Mrs. Duke creativePractice FourA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help. Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself. Statements1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitor a lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 1One day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection IITom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. T aylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. T aylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window,admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything. Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. T aylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. T om, I think you'd better get on with your homework!1. B2. B3. D4. B5. D6. A7. C8. BSection II I(S1 = the first speaker; S2 = the second speaker; S3 = the third speaker; S4 = the fourth speaker)S1: In this week's edition of Up with People we went out into the streets and interviewed a number of people. We asked a question they just didn't expect. We asked them to be self-critical...to ask themselves exactly what they thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard.S2: Well...I...I don't know really...it's not the sort of question you ask yourself directly. I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretary by the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street... Well...then I see someone a bit different. Yes...I'mdifferent in my private life. And that's probably my main fault I should say... I suppose I'm not coherent in my behavior. My office is always in order...but my flat! Well...you'd have to see it to believe it.S3: Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4: Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven. I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.1) secretary 2) hard-working 3) efficient 4) private 5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneListening IMart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I had this good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I should send her out there. It was a cold day in the fall. Well, she took right off and away she went. But she didn't show up when it got dark. I began to worry about her.She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and see if I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was this dog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth." Exercise 1 1. B 2. B 3. A 4. B 5. CExercise 2 1. T 2. F 3. T 4. T 5. F 6. TListening IIThere was an old man who had a daughter. He told his daughter that he had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten them all up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen his knife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papainvites preachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled to the preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these." Exercise 1 1. A 2. A 3. B 4. C 5. CExercise 2 1. T 2. F 3. T 4. T 5. F 6. FListening II IJack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat. So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his wooden one. In no time, that cat had eighteen mice piled up in front of the mouse hole.Exercise 11) stayed around 2) mouse catcher 3) rats and mice 4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat 9) managed 10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice oneKen: Hey, Josh. Where did you get those comic magazines?Josh: When I went home last weekend, I found these old Superman magazines that my older brother had bought many years ago.Ken: You don't have time to read old comics. Why did you bring them here?Josh: In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken: Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh:When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken: How?Josh: Superman is an orphan who comes by rocket to Earth when his native planet explodes. He lands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work and considerationfor others. As an adult, he migrates to a large city and defends Americans against evil. Ken: What else?Josh: Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken: But how does that relate to Superman?Josh: He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values of honesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken: I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh: OK.Exercise 1 1. B 2. A 3. A 4. C 5. DExercise 2 1. F 2. T 3. T 4. F 5.T 6 F 7. F 8.TPractice twoAt one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs instead of only for food.Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painful stiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you." The spirits of the deer would run to the place where a deer had been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If the answer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again. Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them. When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a cure for one of the diseases which animals had caused for mankind.This was the beginning of plant medicines from nature among the Cherokee Indians a long, long time ago.Exercise 1 1. C D J 2. A E G H 3. B F IExercise 2 1. A 2 .B 3. D 4.C 5. B 6. DPractice ThreeEvery March, a flock of buzzards returns to the town of Hinkley, Ohio. No one really knows how long this event has taken place, but according to local legend the annual buzzard migration began nearly 200 years ago with a massacre."The first legend of buzzards in Hinkley, Ohio, goes back to the Great Hinkley Hunt on December 24, Christmas Eve, in 1818. The local settlers deciding that the township needed to be made safe for their livestock, gathered together about 400 men and boys, with guns and clubs and completely surrounded the township of Hinkley."As the story goes, the townsfolk began marching toward the center of town, driving all the game in front of them, and killing virtually every wild animal they encountered. "The settlers took some of the deer and the wild turkeys for the holiday dinners, but left all of the other dead animals out in the snow. When spring came, the remaining dead animals attracted many buzzards, and since 1819 they've been coming back here in March."Hinkley locals have come to appreciate the buzzards' annual return. In mid-March, on Buzzard Sunday, they celebrate the birds' arrival with costumes, exhibits and songs. Exercise 1 1. B 2. D 3. C 4. D 5. AExercise 2 1. F 2. T 3. F 4. F 5.F 6. TPractice FourAlmost seven centuries ago, in Central Asia, there lived a great king called T amerlane. He was a mighty, powerful, conquering soldier, and his greatest ambition was that one day he would rule a massive empire stretching from the Atlantic Ocean in the west to the Pacific Ocean in the east. He made his imperial capital in the oasis city of Samarkand, which he planned to make the most beautiful city on earth. Many magnificent mosques were built and they were decorated with exquisite blue ceramic tiles on the outside, and with pure gold on the inside.Tamerlane, like the great oriental king that he was, had many wives, including a Chinese girl called Bibi Khanym. Now Bibi Khanym was the most beautiful of all T amerlane's wives, and she was also the youngest. She was his favorite wife and was deeply in love with him.In order to demonstrate her great love of Tamerlane, she decided to build a magnificent mosque to honor him, while he was away fighting in a distant war. She engaged the best architect, who designed for her the most magnificent mosque you could imagine. And then she found the best master builder, who began work immediately. But as the weeks and months passed by, the master builder began to fall in love with Bibi Khanym. She resisted all his advances, but at last he threatened to leave the mosque unfinished unless she allowed him to kiss her just once. Bibi Khanym wanted the beautiful mosque finished more than anything else. She was expecting Tamerlane to return any day. So at last she agreed to let the master builder kiss her, just once.But that was her terrible mistake, for so powerful was the master builder's love for BibiKhanym that when he kissed her he left a permanent mark on her face.King Tamerlane returned and saw the guilty mark on his wife's face. The master builder was executed immediately, and then, thinking that a woman's beauty can be a dangerous thing, Tamerlane ordered that from that day on all the women in the kingdom should never be seen in public without a veil to cover their face.Exercise 1 1. B 2 . C 3. B 4. A 5. D 6. AExercise 2 1. F 2. F 3. T 4. T 5.FPart Four Testing YourselfSection 1Long long ago, there was a pretty girl named "Red Riding Hood" because she was always wearing a red hood. One day her mother asked her to take some snacks to her grandmother because her grandmother was ill. Her mother told her, "Don't hang around on your way. Don't leave the main road."On her way, she saw a wolf. The wolf asked her where she was going and she told him that she was going to her grandmother's house. The wolf thought to himself how delicious she would taste. Red Riding Hood danced in the woods, picking flowers for her grandmother and forgetting what her mother had said to her.The wolf went to the grandmother's house and ate up the poor lady. Then he waited in the bed for Red Riding Hood.As Red Riding Hood came into the grandmother's house, she found her grandmother looked rather strange with very large ears, eyes, hands and mouth. And suddenly the wolf jumped out of the bed and devoured the little girl.。

视听说教程3 Unit 01听力及答案

Book III Unit 01 With Alzheimer’s, you meet a lot of new peopleAims: Identifying Signal WordsBringing up Sensitive Topics; Asking for DetailsKey Words:kit: (运动队的)服装(a set of clothes and equipment that you use when playing a sport)photographic memory: 准确得惊人的记忆力mental visualization: 头脑中形成图像、意象association: 联想(a feeling or memory that is connected with a particular place , event, word, etc.) consolidation: 巩固, 加强(the act of making something strong and secure)sieve: 筛子(a wire tool for separating small objects from large objects)toast: 烤面包; 吐司(bread that has been heated and browned in toaster or an oven)check over: 检查(examine; inspect)bacon: 咸肉, 熏肉(salted or smoked meat from the back or sides of a pig, often served in narrow thin pieces) stimulate: 刺激; 促进(encourage an activity to begin or develop further)memorize: 记住; 熟记(learn words, music, etc.)characteristic: 特征, 特性chef: 厨师(a skilled cook who manages the kitchen)recipe: 食谱, 配方(a set of instructions for cooking a particular type of food)Alzheimer's disease: 阿耳茨海默氏病, 早老性痴呆病carton: 硬纸盒, 纸板箱(a box or container usually made of paperboard)cereal: 谷类食物(如麦片等)(a breakfast food made from grain and usually eaten with milk)synthesize: 合成(make something by combining different things or substances)profusely: 丰富地(exhibiting great abundance)pajamas: 睡衣(soft and loose clothes that you wear in bed)implant: 灌输(strongly fix an idea, feeling, or way of behavior in someone's mind)visualize: 设想; 想像(form a picture of someone or something in one's mind; imagine)proficient: 精通(well advanced in an art, occupation, or branch of knowledge)vaccine: 疫苗immune: 免疫的antibody level: 抗体水平mental decline: 智力下降halt: 使停止(stop)reverse: 使逆转(turn around to the opposite direction)beta-amyloid plaque: 贝塔-淀粉状蛋白血小板molecule: 分子undergo: 经历(go through)II. Listening SkillsQuestion 1W: OK, it's your turn to pay the bill. I paid last time.M: What? You have a selective memory. You tried to pay last time, but your credit card failed; so I ended up paying!It's definitely your turn.Q: What is true according to the conversation?Key: CQuestion 2M: I'm having real trouble reviewing for this French exam. I just can't memorize all the vocabulary.W: Me too, I hate having to learn things by heart. I guess we just have to keep reading the texts over and over.Q: What does the woman prefer?Key: DQuestion 3W: Oh look! There's that guy we saw last week, playing football in the park! He looked great in his kit, remember? M: Him? I don't remember him. I've got a terrible memory for faces. I have a hard time even recognizing people I've been introduced to.Q: According to the conversation, what is the man's problem?Key: AQuestion 4M: Why is there a big sign on the back of your door that says "keys"?W: It's to remind me to take my keys when I go out because I'm always locking myself out by accident! It doesn't help though. Now I just forget to read the sign.Q: Why is there a sign on the back of the door?Key: BQuestion 5M: That history exam was really hard. The essay question was terrible!W: I know, I wish I were like David. He has a photographic memory, you know.How useful that would be!Q: What is true of David?Key AIII. Listening InTask 1: Is your memory in good shape?M: Tell me your secret. You're suddenly getting excellent marks in every subject, and you used to be a bottom-of- the-class student just like me.W: Simple enough. I read an article in a scientific journal that linked studying with remembering, based on recent research into the brain.M: Aw, that stuff's old hat: study at the same time every day, be sure your clothes are comfortable, make sure you have enough light, blah-blah-blah.W: Not so fast, wise guy. I'm talking about principles like "Mental Visualization", creating a picture in your mind of what is to be remembered.M" OK, that does sound different. Is "Association" a principle--you know, you connect what you want to remember with something you're familiar with?W: Right on! "Consolidation" is another. I review my notes right after class and consolidate---or absorb--the new material into what I've already learned.M: You're moving ahead fast with those principles. I swear this weekend I'm going to study sixteen hours a day both Saturday and Sunday.W: Whoa, big guy. That's not the way. Follow the principle of "Distributed Practice". Shorter study sessions distributed over several days are better.M: That system is all very well for you; you've got a good memory. But what about me? I've got a memory like a sieve.W: You're too modest. There's nothing wrong with your memory. But memory is like a muscle; it needs exercise.And don't forget it.Key: While the man is wondering why the woman is suddenly getting excellent marks, she says she read an article on studying and remembering. It talks about principles like "Mental Visualization", that is, creating a picture in one's mind of what is to be remembered. This reminds the man of the principle of "Association", which means connecting what one wants to remember with something one is familiar with. Then the woman adds theprinciple of "Consolidation", or reviewing one's notes after class and absorbing the new material into what one has already learned. When the man promises to study six-teen hours a day, the woman recommends the principle of "Distributed Practice", which favors shorter study sessions distributed over several days. Finally, the woman tells the man that memory is like a muscle, and that it needs exercise.Task 2: You forgot my toast!An 80-year-old couple was having problems remembering things, so they decided to go to their doctor to see what was wrong with them. They explained to the doctor about the problems they were having with their memory. After checking the couple over, the doctor told them that they were physically okay but might need to start writing things down to t~elp them remember. The couple thanked the doctor and left.Later that night while watching TV, the old woman said to the old man, "Honey, will you please go to the kitchen and get me a dish of ice cream?"Before the old man left, she added, "Why don't you write that down so you won't forget?""Nonsense," said the husband, "I can remember a dish of ice cream !""Well," said the wife, "I'd also like some strawberries on it. You'd better write that down because I know your memory is failing.""Don't be silly," replied the husband. "There're only two things: a dish of ice cream and some strawberries. I can surely remember that!"With that, he rushed into the kitchen. After about twenty minutes he returned from the kitchen and handed her a plate of bacon and eggs.The wife took one look at the plate, glanced up at her husband, and said, "Hey, you forgot the toast!"F 1. The couple went to their doctor to have a complete physical checkup.T 2. At first the wife asked the husband to get her only ice cream.F 3. The husband refused to write a note, for he believed he could remember the toast.F 4. Finally, the husband brought the wife both ice cream and strawberries.F 5. The wife blamed the husband for forgetting to bring her ice cream and strawberries.For Reference1. He thought he could remember two things--a dish of ice cream and some strawberries.2. She took one look at the plate, glanced up at him, and blamed him for forgetting her toast.Task 3: Memory-Improving TechniquesThere are many techniques you can use to improve your memory. Some of them are introduced here.First and foremost, you need to stimulate your memory all the time. To put it simply, you should use your memory as much as possible. It is especially important to try to learn something new. If you work in an office, learn to dance; if you are a dancer, learn to deal with a computer; if you work with sales, learn to play chess; if you are a programmer, learn to paint. These added activities stimulate the brain so that it continues to function.Older people need to pay attention to things they are dealing with. Don't try to memorize everything that catches your attention; focus on what you consider important. For example, you can take any object such as a pen and concentrate on it. Think on its various characteristics: its material, its function, its color, and so on. Don't allow any other thought to occupy your mind while you are concentrating on that pen.Another method that can be used is to relax yourself. It is impossible to remember things if you are tense or nervous.So, try holding your breath for ten seconds, and then release it slowly.Association is also a powerful tool to develop your memory. For example, if you cannot remember a person's name, you can think about a special feature of his face and then link it with his name.Questions:1. What seems to be an especially important way to stimulate one's memory?A) Learning different things.2. What seems to be the best way to focus your attention?C) Concentrating only on what is important.3. How can you concentrate on a pen?D) You can focus on its features.4. How can you relax yourself according to the passage?B) You can stop breathing in for a short time, and then breathe out slowly.5. What is the main idea of the passage?D) Memory-developing skills.For ReferenceStimulating one's memory, paying attention (or focusing/concentrating one's attention), relaxing, and making associations.IV. Speaking OutMODEL 1 It slipped my mind!Amy: I sent out the invitations to the dinner party.Bill: That's good. Now what should we do?Amy: We've got to plan the menu.Bill: Oh, that's right. Do you have anything in mind?Amy: I think I'm going to make the chicken salad we had at the Christmas party. Remember I asked the chef for the recipe?Bill: Yeah, but did you forget that Linda doesn't eat chicken?Amy: Linda? Oh, my gosh! I forgot to invite Linda! It just slipped my mind. She'll be mad at me.Bill: Well, everyone forgets something sometimes. It's not too late yet. I'll make a phone call. Don't worry.Amy: Thanks! You see, I'm getting forgetful. I think I'm getting old!Bill: Looks like you are, sweetheart.Now Your TurnSAMPLE DIALOGA: I'm going to throw a party, and I've sent out the invitations to my friends and relatives.B: That's good. But don't forget to invite everyone you should invite.A: I think I've invited everyone. Do you have anybody in mind?B: Did you invite John? He's lost his job after a recent quarrel with his boss.A: Oh, my gosh! I forgot to invite him! He'll be sad, thinking we look down on him. He just slipped my mind.B: Well, everyone forgets something sometimes. Don't worry. It's not too late. Make a phone call right away.A" Did I forget anybody else that I should invite?B: There's yet another person you should invite--Julia. She's just moved to the city and feels lonely.A: Oh, good heavens, I forgot all about her. She's our new friend. You see, I'm getting forgetful. I think I'm getting old!B: Looks like you are, buddy. You'd better start writing things down if they're important.MODEL 2 I can’t think of it off the top of my headJohn: Hey, Sue. Do you know what Jack's home phone number is?Susan: I can't think of it off the top of my head. I don't have my address book on me, and I don't have my mobile phone with me, either.John: That's too bad! I've got to find him now. It's urgent! If I can't find him today, I'll be dead!Susan: You might want to look it up in the phone book.John: I've checked already, but it seems that his phone number is unlisted.Susan: Maybe it's under his roommate's name.John: Well, I guess so.Susan: Well, why don't you call Jane? She has his phone number.John: I've tried, but no one answered!Susan: Maybe call his office and ask his secretary.John: I've already tried. She won't tell me. She says it's private.Susan: Oh, that's right. They usually don't release private information over the phone.John: It's a pity. You usually have a powerful memory, but you can't help today. What's wrong with you? Your memory seems to be fading early.Susan: It's not that my memory is fading. I do have a good memory for faces and names, but a poor one for numbers and dates.Now Your TurnSAMPLE DIALOGA: Hey, do you remember when is the lecture on the value of information by Professor Smith?B: I can't think of it off the top of my head. Maybe we can look it up in our notebooks, but I don't have mine with me. A: That's too bad! I don't have it with me, either. Do you remember the number of the lecture hall?B: Sorry, I can't think of it off hand.A: I'm terribly interested in the lecture. I can't miss it!B: Well, why don't you call the dean who arranged the lecture?A: I'm afraid it's not very wise to ask the dean directly.B: Then maybe you can call the office of the department and ask the secretary.A: I've already tried, but no one answered.B: Oh!A: You usually have a powerful memory, but you can't help today. Your memory seems to be fading early.B: It's not that my memory is fading. I do have a good memory for faces and names, but a poor one for numbers and dates.MODEL 3 What’s wrong with your memory?Bill: Hi, honey! My trip to London was wonderful.Amy: Tell me what thrilled you most.[The telephone rings and Bill answers it....He hangs up. ]Bill: Er, where was I?Amy: You were talking about your tour in London.Bill: Oh, yeah.Amy: I bet you had a great time.Bill: Yes, I particularly enjoyed visiting the Tower of London.Amy: How did you get there? By bus or underground?Bill: Let me see....Sorry, I can't remember any more.Amy: What's wrong with your memory?Bill: I hope it's not Alzheimer's disease. I don't want to forget my own name.Amy: I don't think so. Perhaps it's just temporary forgetfulness. You'll be all right after a good sleep.Bill: I hope so. But as this is happening so often recently, I think I must go to see a doctor and get some pills. Amy: It's not as serious as that. Anyway, I wish you had a good memory for happy events, and a bad one for unhappy things.Now Your TurnSAMPLE DIALOGA: Hey, my trip to Beijing was fantastic.B: Tell me what interested you most.[The door bell rings and A answers it....A comes back.]A: Well, where was I?B: You were talking about your tour in Beijing.A: Oh, yeah.B: I bet you had a great time.A: Yes, I particularly enjoyed visiting the Forbidden City and the Great Wall, though the admission fees were a bittoo high for me.B: What were the fees?A: Let me see....Sorry, I can't remember any more.B: What's wrong with your memory?A: I hope it's not Alzheimer's disease. I don't want to see a lot of new people everyday.B: I don't think so. Perhaps you only forget things momentarily. You'll be all right after a good sleep.A: I hope so. But as this happens so often recently, I think I have to go to see a doctor.B: I don't think it's so serious. Anyway, a bad memory helps you to forget your troubles.V. Let’s TalkHow to improve your MemoryStudent: Professor, thank you for granting me this interview. I'm Susan, a reporter from the Student Union magazine. Many students have difficulty memorizing things. Since you're an outstanding psychologist, could you give us some tips on how to improve our memory?Professor: Well, some people have better memories than others, but that's largely because they are better at creating mental images.Student: If I'm not good at creating images, what can I do?Professor: Practice helps. And the mind remembers things better if they are connected with other images. For example, if you have to pick up several items at the grocery store, say, carrots, eggs, bananas, and milk, you can create a picture in your mind of a giant carrot, and hanging from it, a banana.Student: Then I could have a giant milk carton pouring milk over the carrot and banana.Professor: Certainly. Then what would you do with the egg?Student: Hmmm. I'd visualize an egg-shaped UFO flying across the sky.Professor: There you go. The more you apply the ideas, the easier it gets. Besides creating pictures, there's another technique that is very useful.Student: What is it?Professor: Establishing an association. Suppose you are looking for lost keys. Relax, and let your mind look for all the images connected with those keys -- their feel, the sounds they make.Student: How will that help?Professor: You might remember the sound the keys made when you placed them in a drawer or the cold touch of the keys in your jacket where you left them.Student: Oh my gosh! I have to run. It's time for my English class. I see an image of my teacher staring at my empty seat in the classroom. Many thanks, Professor.Professor: Not at all, and good luck with your memory.VI . Further Listening and SpeakingListeningTask 1: The role Memory Plays in Our LifeSince memory plays a significant role in our life, scientists are increasingly interested in research on how to improve memory. Here are some factors they believe to be important in expanding memory capacity. To begin with, you must take special care in your daily life. Food for example, is very important. Some vitamins are essential for your memory to work properly. They are found in bread, cereal, vegetables and fruits. Some experts say that synthesized vitamins improve memory, but others have doubts about this, arguing that the studies have not confirmed they do work. Another essential factor is water. It helps to maintain the memory systems, especially in older persons. According to Dr. Rosewell, lack of water in the body has an immediate and strong effect on memory; it can cause confusion and other thought difficulties. Sleep also plays a significant role. To be able to have a good memory, we must allow the brain to have plenty of rest. While sleeping, the brain no longer controls the senses, and starts to revise and store the information one has received. Lack of sleep would make one feel exhausted and would weaken one's ability to concentrate. Also, one's ability to store information would be affected.Keys:1. What is the passage mainly about?A) Factors related to memory development.2. Why are foods important in promoting memory according to the passage?B) They contain vitamins.3. To whom is water especially important in maintaining the memory system?D) Older people.4. What problem can a lack of water cause?D) All of the above.5. Why is sleep important to memory?C) Sleep helps the brain to revise and store information.Task 2: Where did the professor go?This is a true story, which happened to friends of ours in a small town in South Africa. They were a hospitable couple who often entertained their neighbors for drinks, tea or dinner. On this particular spring night, they had invited a retired professor to supper. During the evening, it began to pour with rain, and the heavens really opened. Because he had walked there, they offered to put him up for the night. They pointed out that by staying overnight, he did not need to go out in the bad weather. He agreed on the soundness of that idea, thanked his hosts profusely, and the matter seemed to be settled. But while they were washing the dishes after supper, the forgetful professor disappeared. No one could find him anywhere. Eventually, after about 40 minutes, the front door bell rang. There was the professor, soaked to the skin. When he was asked what on earth he had been doing in the rain, he replied that because he was going to stay there overnight, he had gone home to get his pajamas and toothbrush.Task 3: How to Remember NamesYou just called the TV repair shop, and the voice on the other end of the line tells you, "This is Don Smith". About 5 minutes later you tell your wife that "this guy" will be out to fix the TV in the morning. You can't think of his name although you know he mentioned it on the phone.This happens all the time to just about any of us unless we have learned to concentrate and implant a name in our memory, right at the time we hear it. To do this, you must make a habit of repeating the name back to the person. This action will remind you to store the name in your "memory bank" each time you hear someone's name, and within a short time the "repeating" process can be discontinued.When you meet someone in person, use the same procedure, and in addition, visualize something different, unusual or ridiculous about his or her appearance, position, or actions that "ties in" with his or her name. Later, you may write the descriptive information on one side of a card and the name on the other side. Look at it repeatedly, see the "picture" in your mind's eye as you look at the name; or when you see the name, visualize the "picture" you haveassigned to the name.Getting this system to work will require changes in your thinking, and it may take several days or several weeks to become proficient.For Reference1. Maybe we can't think of the name.2. We can repeat the name back to the person.3. We can repeat the name. In addition, we can visualize something different, unusual, or ridiculous about his or her appearance, position, or actions that "ties in" with his or her name.4. The descriptive information on one side of the card and the name on the other side.5. We can look at it repeatedly, see the "picture" in our mind's eye as we look at the name; or when we see the name, visualize the "picture" we have assigned to the name.News Report: A Dolphin ExhibitionA recent art exhibition in Florida honored the animal often seen as man's most intelligent friend, the dolphin. The "Dolphins on Parade" exhibition in the Florida Keys featured life-sized decorated dolphin paintings made of wood and other materials. The dolphins were shown at area businesses and along the beach. Sponsors paid U.S.$750 to cover the artists' fee and the cost of materials.There were more than 100 dolphin themes, including a beer-belly dolphin. They showed the work of local artists, as well as the beach atmosphere the Keys are famous for.Probably the most unique was special because of its artist, Pandora. Pandora the dolphin painter is a real dolphin, at the Dolphin Research Center, in Marathon, Florida. The playful artist streaks colors across a dolphin painting, holding a brush in its mouth.The exhibition was held by the Monroe [Florida] Council of the Arts as part of a plan to make the Keys an international arts center. The paintings were to be auctioned off in March, with the money earned going to community art programs.。

新编大学英语视听说教程三册答案

Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. Barbara Exercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combination Listening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5. travel around in6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign languagePractice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerancelevel 5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; lookbigger 9. round ; tail-wagging10.feeding; every directionPart TwoListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regularmail; fax 4.traveler’s checks; credit cardsPractice TwoExercise 1(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7. records8. agree9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. aTHANKS !!!致力为企业和个人提供合同协议，策划案计划书，学习课件等等打造全网一站式需求欢迎您的下载，资料仅供参考。

新标准大学英语视听说教程3答案

Unit 1 Outside view: Activity 3Row 1: 2 Row 2: 1 Row 3: 4 Row 4: 1 Row 5: 2 Row 6: 1 Row 7: 3Unit 1 Listening in: Passage 1 Activity 1Question 1 Key: c Question 2 Key: d Question 3 Key: aQuestion 4 Key: bUnit 1 Listening in: Passage 2 Activity 2Question 1 Key(s):(1) strengths (2) weaknesses (3) personality (4) like(5) subjects (6) organized (7) confident (8) outgoing (9) a team(10) working alone Question 2 Key(s):(1) future careers(2) into a particular area of work (3) chosen field(4) related industries (5) leadingQuestion 3 Key(s):(1) vocational (2) graduates (3) high-flyers (4) career (5) practical (6) transferable (7) recruitmentUnit 2 Outside view: Activity 2(1) where there is war(2) go to school(3) working in 157 countries/working in one hundred and fifty-seven countries(4) has never known peace(5) bringing medicine(6) get an education(7) 40,000 kids/forty thousand kids(8) girls were not allowed(9) 50 per cent/50 percent/fifty per cent/fifty percent(10) running the school for 12 years/running the school for twelve yearsUnit 2 Listening in: Passage 2 Activity 1 Correct order: 3, 6, 1, 4, 2, 5Unit 3 Outside view: Activity 2(1) most famous painting(2) broke all the rules(3) looking directly at(4) a sense of movement(5) indicated a real place(6) what is she trying to say(7) covered up one side of her face(8) we're the subject(9) seemed happier(10) the mystery about her(11) line up between(12) tell a storyUnit 3 Outside view: Activity 3Row 1: 2Row 2: 1Row 3: 1Row 4: 1Row 5: 2Row 6: 1Row 7: 1Row 8: 2Row 9: 1Row 10: 2Row 11: 1Row 12: 2Unit 3 Outside view: Activity 4Correct order: e, a, d, b, c, g, f, hUnit 4 Listening in: Passage 1 Activity 2Unit 5 Outside view: Activity 4 Correct order: 2, 10, 13, 3, 7, 8, 1, 9, 11, 14, 5, 6, 12, 4Unit 6 Outside view: Activity 2Unit 6 Listening in: Passage 2 Activity 1Question 1Key(s): zookeeperQuestion 2Key(s): Al GoreQuestion 3Key(s):making people take climate change seriouslyQuestion 4 Key(s): Greenpeace Question 5 Key(s): mum, part-time accountant Question 6 Key(s):Melinda GatesQuestion 7 Key(s):co-founding the Bill and Melinda GatesFoundationQuestion 8Key(s):Save the ChildrenUnit 9 Outside view: Activity 2Unit 9 Listening in: Passage 1 Activity 3Question 1 Key(s):(1) attractive, powerful(2) attractive, powerfulQuestion 2 Key(s): to think of Question 3Key(s): much too long Question 4 Key(s): meaning very small Question 5Key(s): the best or the strongest Question 6 Key(s): most romantic lovers Question 7Key(s): sound luxurious。

(完整word版)新编大学英语视听说book3Unit5听力答案及文本

Unit 5 language1Part 1Listening IEvery culture has its own way of saying things, its own special expressions. These are the living speech of a people. The" soap" expressions in English are just one example.Soap operas are radio and television plays about the problems and emotions in human relationships.They are called soap operas because the first programs-years ago-were paid for by soap-making companies.Like musical operas, soap operas are not about real people. And critics charge that they do not represent a balanced picture of real life. They note that almost everyone in a soap opera has a serious emotional problem, or is guilty of a crime. And there are several crises in every program. Yet, soap opera fans do not care about what the critics say. They love the programs and watch them every day.Such loyalty has made soap operas very popular in the United States. In fact, A few programs are so popular that they have been produced with the same actors for many years.Another expression that uses the w ord soap is “soap box”.There was a time when soap and other products were shipped in wooden boxes. The boxes were small, but strong. You could stand on one to see over the heads in a crowd or to be seen in a crowd. Soap boxes were a simple, easy way to make yourself taller if you wanted to give a public speech. Such soapbox speeches usually were political and one-sided. The speakers shouted their ideas to anyone who walked by. Many talked for hours refusing to get off their soap boxes.Today, you don’t n eed a wooden box to make a soapbox speech. Anyone, anywhere, who talks endlessly about a cause is said to be on a soap box,.Another, quieter way to win support or gain influence is to “soft-soap” a person. This means touse praise or other kind words to get the person to do what you want.Exercise 11. plays，real people，real life，emotional problem，popular2. public speech, make themselves taller, political, one-sided3. soft-soap, praise, kindExercise 2F F T T T TListening IIA: Do you think learners should try to speak English with a native-speaker pronunciation?B: That's a difficult question to answer. I think the most important thing is to be understood easily. For most learners, it's not necessary or desirable to speak like a native speaker. For some learners, for example, those who eventually want to teach English, or be interpreters perhaps, anative-speaker pronunciation is the ultimate goal. At least, that's what I think.A: Children often do not want to speak English with a native-speaker pronunciation. Why not? B: In general, children are splendid mimics and imitate strange sounds very easily and well. However, it is true that most children do not want to sound "English" when they are speaking English. This may be partly due to shyness but I think the main reason is that most children want to belong to a group—they dress alike, listen to the same music, share the same opinions and hobbies. Even if a child can speak English like a native speaker, he or she will usually choose not to—unless, of course, the rest of the group speaks with a native-speaker pronunciation too.A: What is the main reason why adults find pronunciation difficult?B: Numerous reasons have been offered for the difficulties which many adults find with pronunciation and, no doubt, there is some truth in all of these. It seems to be the case that children are better mimics than adults. But if an adult really wants to achieve a native-speaker pronunciation, then he or she can. It is NOT the student's own language that prevents him or her from achieving a native-speaker pronunciation in English. It is the fact that the adult student has a strong sense of national identity. In other words, he or she wants to be identified as a German or Brazilian speaking English. In my opinion, this sense of national identity is more important than other explanations, such as the greater anxiety of adults or the effect of their own language habits.Exercise 11 C2 A 3DExercise 21.be understood easily2.necessary, desirable3.splendid4.prevent, from achieving5.anxiety, effectListening III(Dr.Mallard is an expert on bilingual education. She has a show on radio through which she answers questions from parents about how to raise their children to be bilingual.)Dr.Mallard: Hello, sir. You are on air.John: Oh, hello. Dr.Mallard?Dr.Mallard: Yes, How may I help you?John: Dr.Mallard, my name is John. My wife Maria and I just had our first baby girl.Dr.Mallard: Congratulations, John. You must be very excited.John: Yes, we are indeed. Here is why I called. Maria is from Peru, and speaks fluent Spanish and fairly good English, depending on the situation. I am a native English speaker and I also speak almost fluent Spanish. We live in the U.S and communicate in Spanish at home 95% of the time. Dr.Mallard: I see. Please go on.John: My question is this: how should we communicate in order to ensure the bilingual successof our child?Dr.Mallard: OK. From what you told me I guess you and your wife have already started using mostly Spanish with your newborn girl. Is that correct?John: Yes. I think using Spanish with her just feels kind of natural to both of us.Dr.Mallard: That is fine, because language uses within a family should be natural: we use the languages to build a fa mily relationship, not to “teach” the languages.John: But is it reasonable to assume that our baby will be exposed to enough English in the world outside our house and therefore it will be OK for us to speak to her almost solely in Spanish? Dr.Mallard: Well, in my opinion, yes. And I also believe that your baby will have a lot of exposure to English at home as well. She will listen to not only music and talk on the TV, but also relative and friends who are visiting or telephoning. Besides, she may also have English input from you yourself: for example, you may want to sing to her the English-language nursery rhymes that you remember from your own childhood.John: Ok. That really eases my mind. Thank you so much, Dr.Mallard.Dr.Mallard: You are welcome.Exercise 1T F F F T TExercise 21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IVTalk show host:Welcome to tonight's program. Our guest is Dr. Charles Adams, language learning specialist. His book, Learning a Language over Eggs and Toast is on the best seller list. Welcome.Dr. Adams: Thank you.Talk show host: Tell us about the title of your book.Dr. Adams: First, it is important to establish a regular study program, like planning a few minutes every morning around breakfast time .Talk show host : But, I took Spanish for four years and I didn't become a proficient speaker of it. Dr. Adams: Well , we can become fluent speakers in a matter of a few minutes here and there. We should follow a regular course of study and remember that there is a difference between native fluency and proficiency in a language. I propose the latter.Talk show host: What are the basic keys you suggest ?Dr.Adams: People must organize their study by setting realistic and attainable goals Some people think they can learn the language in 30 days and become discouraged when they can’t.. Small steps are the key. Learning five new words a day and learning to use them actively is far better than learning 30 and forgetting them the next day.Talk show host: Um-hum. You mentioned individual learning styles. Can you explain what you mean by learning style?Dr.Adams: Sure .People have different ways of learning .Some are visual learners who prefer to see models of the patterns they are expected to learn. Other are auditory learners who favor hearing instructions over reading them.. Our preferences are determined by factors such as personality ,culture, and past experiences.Talk Show Host: What is your learning style?Dr. Adams: I learn by doing.Talk show host: What do you mean by that?Dr.Adams:I know it might sound unusual, but moving around while trying to learn helps me.While I cut up tomatoes and onions for my breakfast in the morning ,I might recite aloud vocabulary to the rhythm of the knife .Talk show host : What is my learning style?Dr.Adams : You're going to have to read my book to find that out.Talk show host : Okay Thank for joining us.Dr.Adams: My pleasure.Exercise 11 C2 C3 A4 BExercise 2。

新编大学英语视听说3Unit1听力原文和答案

3Unit1 听新编大学英语视听说力原文和答案Unit 1Part OneListe ning IIn terviewer: An gela, you were born in Korea but you've been living in Canada for a long time, have n't you?An gela: Yes, I was 10 years old whe n my pare nts immigrated to Can ada and「ve bee n livi ng here for 20 years now.In terviewer: Do you thi nk that bel onging to two differe nt cultures has affected your pers on ality? Angela: Yes, definitely. There are times when I think that I have two pers on alities. Depe nding on where I am and who「m with, I'm Korea n or 「m Can adia n.In terviewer: That sounds complicated. Could you expla in what you mean?An gela: Well, grow ing up in Can ada whe n I was going to high school, for example, I was known as An gela to the outside world, and asSun-Ky ung at home. I would wave hello to my teachers, but bow to my pare nts' Korea n frie nds whe n they visited our home.In terviewer: Do differe nt cultures have differe nt ideas as to what is polite?An gela: Yes, defi nitely .In high school, I was expected to look straight in the eyes of my teachers and to talk ope nly with them. But whe n Korea ns spoke to me, I was expected to look at my feet and to be shy and sile nt.In terviewer: Do you thi nk that hav ing two pers on alities makes you a richer pers on?An gela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello4) bow5) look straight in the eyes of 6) ope nly 7) look at my feet8) shy and sile ntListe ning III am a very sen sitive pers on, and that's good to a poin t. I feel every one should be able to feel or un dersta nd what others are going through. But whe n you suffer and cry for people you don't know, or over a movie that s 6nly a story, then I think that's a little too sen sitive. That's the way I am.I am also a very in depe ndent pers on. I must do things by myself. I don't like people doing things for me, or helpi ng me, or givi ng me thin gs. It's not that I don't appreciate it. I just feel that whe n some one does somethi ng for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone any thi ng.I thi nk I would be a good frie nd. I would do almost any thi ng for some one I like; and I would share orgive any thi ng I have. I'm very cari ng and understanding. People trust me with their secrets, and they're right for doing so because I n ever tell others any secret that is told to me. 「m always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good.I find fun in almost everyth ing I do (except housework). I like to watch people, talk to them, and be around them. It makes no differe nee whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy lear ning and being aware of everyth ing and every one around me.Exercise 11. sen sitive/ cari ng in depe ndent / un dersta nding2. good friend3. life people4.learning being awareExercise 21. B2. C3. A4. D5. BListe ning IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Ci ndy and I are going ice-skati ng on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for n ext week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cin dy's sister, Kristi. We could double-date. She's really outgo ing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-ce ntered. She could n't stop talk ing about how great she was. I'm not sure if I can trust you, "Mr.Matchmaker".Bill: Oh come on. So I made a mistake last time. Ci ndy's sister is really differe nt.Tom: Well, what does she look like?Bill: Ah. Looks aren't importa nt. She has a won derful pers on ality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter tha n you are.Tom: Go on.Bill: She has a great figure, a nice complexi on, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kiddi ng. By the way, she was the runn er-up in the Miss California BeautyPagea nt two years ago. Well, you're probably notin terested.Tom: No, wait!Bill: Ah, just forget I ever men ti oned it.Tom: No, I'm in terested!Exercise 11. ice-skating2. chemistry3. outgoingbright funny 4. self-ce ntered5. blond medium height6. runn er-upExercise 21. T2. F3. T4. F5. FListe ning IVDavid: Barbara, before you go, could you tell me about these stude nts that are com ing into my class?Barbara: Oh, yes. Now, let me think, well,there's…er…Paul. He's a tall, slim lad with fair hair. Very frie ndly face, lovely smile... He's particularly good with group activities, and he's a very helpfulpers on to have in the class and very helpful with the other students. He speaks flue ntly, but does make a lot of mistakes! He does n't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susa n...Susa n. Now, she's very lively, quick, and very bright. She talks all the time but not always in En glish.David: What? Is she difficult or an ythi ng? Barbara: No…she's quite young but she does behave in quite a grow n-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very ni ce. She has dark hair and dark eyes.David: Right, well…are there any other girls in the class?Barbara: Y es, there is Maria. She's Susa n's sister.David: Y es.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has Ion ger hair tha n Susan. She's not quite as bright as her sister and I thi nk that makes her feel a bit in ferior really. Well, you know, she sulks a bit whe n she gets things wrong or she misun dersta nds you. But on the whole, a very sen sible girl.David: OK.Barbara: And the n there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brow n hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determ ined to lear n as much as possible. He asks quite difficult questi ons but he does n't mean to be n asty.David: Well, tha nks, Barbara. It's all up to me now, is n't it? Have a good holiday, won't you?Barbara: Tha nks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susa n5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter AG IFurther Liste ningListe ning IOne day, whe n Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sen sible tha n his wife, so he started to give her a lecture on the importa nee of always remai ning calm.Fi nally he said, "It's a waste of your stre ngth to get excited about small thin gs. Train yourself to bepatie nt, like me. Now, look at the fly that has just Ian ded on my no se. Am I gett ing excited or anno yed? Am I sweari ng or wavi ng my arms around? No. I'm no t. I'm perfectly calm."Just as he had said this, Mr. Smith started shouti ng. He jumped up and bega n to wave his arms around wildly and swear terribly. He could n't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sen sible 3) lecture 4) calm 5)stre ngth6) Ianded 7) swearing 8) perfectly 9) wildly 10) beeListe ning IITom: Oh, that Mr. Taylor. He is so bori ng! Mother: What do you mean?Tom: His less ons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darli ng?Tom: Yes, he gets angry very quickly.Mother: That does n't sound like Mr. Taylor at all!Tom: And do you know, he spe nds all the time look ing at his reflecti on in the win dow, admiri ng himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And con ceited! He thinks he knows everythi ng.Mother: Oh, Tom. Be reas on able. I'm sure you're exaggerati ng. Mr. Taylor seems such a ni ce, kind man.Tom: Well, he isn't. He is mea n and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I un dersta nd. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7.D 8. CListe ning III1. Pedro sleeps only six hours a ni ght. He goes to school full-time and works part-time in theafter noons. At ni ght he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of pers on is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The stude nts did n't un dersta nd. He had to repeat his less on and expla in the idea more slowly. Over the next few days heexpla ined and expla ined the less on un til almost the whole class un derstood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street n eighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom.Each one saw the chair he wan ted to sit on. Unfortun ately, it was the same chair. They both sat dow n at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, the n you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of pers on is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She faste ned a basketball hoop over the wastebasket. Now the stude nts love to practice throwing their paper into the basket. When they miss, they pick the paper up and try aga in. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. MillerD patie nt3. Mr. Smith E ho nest4. Jake A stubbor n5. Mrs. Duke F creative Exercise 21. favorite way to relax2. how to divide3. bad un ripe4. stiff sore5. faste ning a basketball hoop Liste ning IVA nu mber of visitors to the UK, who had traveled throughout the British Isles, were asked by a n ewspaper reporter what their impressi ons of the British people were. Here's a brief summary of what they thought.There were many differe nt opinions among those in terviewed: Some were very flatteri ng, others very critical. The distinction between the En glish and the British was n't always un derstood, but, onthe whole, it seemed that the Scots were very popular with visitors. They were thought to be very frie ndly, eve n though one Dutch visitor con fessed she'd found it hard to un dersta nd their En glish.A great n umber found the British gen erally reserved, particularly the En glish, although one Australian visitor called the English "the frien dliest people in the world and most hospitable". But she did admit that speaking the same Ian guage was a great help.Some Asia n bus in essme n, who had traveled widely throughout En gla nd, said quite ope nly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much ni cer", one of them said, with a playful smile on his face, "By much ni cer I mea n much more like us!"A few con ti nen tals praised "En glish courtesy", but the majority found it dish on est and dull."Yo u're forever say ing 'please' and 'sorry' whe n you don't feel pleased or sorry," one expla in ed.A young stude nt from South Africa had no views on the matter. He had n't met anyEn glishme n, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scots' English 2) the friendliest people 3) much nicer than 4) En glish courtesy 5) no views on the matter/ nocomme nts on the matter。

新编大学英语课后答案第三册浙江大学版共13页word资料

Unit 1Part onepreparation1.1）Gentle 2）Dedicated 3）Considerate 4）Adventurous 5）Calm 6）Aggressive 7）Critical 8）Energetic 9）Selfish 10）Ambition 11）Self-confident 12）Easygoing 13）Truthful 14）Outgoing 15）Frank 16）Sensitive 17）Bossy 18）Patient19）Talkative 20）Persuasive 21）Sympathetic 22）Emotional2.Jobs Personalitysalesperson undependable、shrewd、tricky、boastfulteacher knowledge、talkative、patient、energetic、unselfish、tolerantdoctor calm、skillful、sympathetic、careful、unselfishpolice office brave、calm、alert、carefulaccount cautious、careful、efficient、truthfullawyer knowledge、persuasive、talkative、expressive、intelligent tourist guide energetic、good-tempered、talkativehost or hostess of a show quick-minded、humorous、knowledge、expressive、emotional reporter adventurous、brave、curious、efficientsecretary considerate、careful、efficient、easygoingspokesperson diplomatic、intelligent、eloquentPart twopost-readingReading Comprehension1.1）much unhappiness2）a profound effectusually act with confidenceare likely to be passive and easily influenced by others3）i）Recognize your personal strengths and weaknessesii）Set reasonable goalsiv）Don't be afraid to speak up and give your point of viewv）Do not make negative comments about yourselfvi）Accept criticism thoughtfullyviii）Do not associate with people who make you feel inadequateix）Set aside time to relax，enjoy hobbies，and reevaluate your goal regularx）Practice being in social situation2. 1）FTTTF 6）TFFTVocabulary1.1）self-conscious 2）self-confidence 3）self-esteem 4）self-destructive 5）self-worth6）self-concept 7）self-awareness 8）self-assurance/self-confidence2.1）B 2）I 3）L 4）A 5）H 6）D 7）E 8）N 9）J 10）M 11）C 12）F 13）G 14）K3.1）profound 2）jealousy 3）numerous 4）overweight 5）overcome 6）eventually7）slim 8）compliments 9）diminish 10）reassurance 11）detrimental 12）isolated 13）self-esteem 14）accented4.1）reflected 2）concerned/worried 3）profound effect/influence 4）viewed/regarded5）sensitive 6）respond/react 7）eliminated 8）over my fear 9）concentrate on 10）made no commentTranslation1）You should set aside a reasonable amount of time to rest and exercise.2）In general，children are mush healthier and better educated than ever before.3）He can grasp the chances that come along.4）Each day，he sets aside time to be with his family and enjoy life.5）I still remembered those dark streets and the scene I walked hand in hand with my father.6）He eventually didn't live up to his parents' expectations.7）In contrast，our use of oil has enormously increased.8）Through efforts，he managed to overcome his fatal weakness.Part ThreeFURTHER Development1. 1）BBABC 6）CBCAA 11）CBUnit 2Part onepreparation4.matching pictures1）Aphrodite 2）Ares 3）Hephaestus 4）Artemis 5）Demeter 6）Dionysus 7）Poseidon 8）Athena 9）Apollo 10）Hermes 11）Hera 12）ZeusPart twopost-readingReading Comprehension1.1）Because they were invited to a feast in the sky.2）He saw the birds were busy preparing.3）He planned to go to the feast/sky with the birds.4）They don't agree because Tortoise was mischievous and ungrateful.5）With a sweet tongue, he convinced the birds that he was a change man.6）He made two wings with all the feathers he got from each bird.7）All of you.8）Nuts, meat and fish soup, pounded yam soup, palm wine, etc.9）For whom have you prepared this feast?10）Because he knew the answer would be "For all of you", which was his new name. So he could enjoy all the food.11）They were very angry.12）They took back the feathers they had lent him.13）He asked them to take a message to his wife.14）Parrot，because he wanted to take advantage of the change to get revenge.15）He asked Parrot to tell his wife to bring out all the soft things in his house and cover the ground with them so that he would be able to land safety. But Parrot told his wife to bring out allthe hard and sharp things instead.16）His shell was broken into hundreds of pieces.Vocabulary1. 1）A.invitation B.invited C.inviting 2）A.prepare B.prepared C.preparationD.preparatory/preparation 3）A.discoveries B.discoverers C.discovered4）A.approval B.approve C.approved D.approving E.disapprove 5）A.eloquentB.eloquenceC.eloquently 6）A.faithful B.unfaithful/faithless C.faithD.faithfully 7）A.occasional B.occasionally C.occasion 8）A.delivery B.delivering C.delivered 9）A.troublesome B.troubled C.troubled D.troubling 10）A.assurance B.assuredC.assure2. 1）got/ran into trouble 2）no trouble 3）asking for trouble 4）have...trouble 5）trouble with6）in serious/deep/big trouble 7）get/getting...into trouble 8）took the trouble3. 1）with a pattern of roses2）prepared a wonderful/good/large meal for us3）promised faithfully4）deliver the letter5）a selection of milk and plain chocolate6）keep out of mischief7）the sound of distant thunder8）been approved by the government9）despite the fact that he drank too much10）reach an agreement whether the drug is safe or notPart ThreeFURTHER Development1. 1）CCABA 6）BABBA 11）BA5.1）the true reason why there was no such animal in Guizhou2）they were useless in this place3）When he suddenly saw the donkey, he thought it was a monster4）He hid himself in the tree while looking at donkey5）What kind of animal is this and why does it look different from other animal that I've ever seen6）But one day the donkey stretched its thin neck and cried7）the tiger found that the donkey didn't have any other skills besides crying8）But he dared not rush to it and eat it just as he did to other animals9）This did make the donkey angry，so it raised its hind leg and kicked the tiger10）This time he rushed to it without hesitation and bit is throatUnit 3Part twopost-readingReading Comprehension1.1）financial 2）career 3）later 4）guilty 5）hurt 6）resentful 7）productive8）independence 9）responsibility 10）trusted 11）frightening 12）resentment13）abandoned 14）factors 15）quality2.1）TFTFT 6）FFFFFVocabulary1. 1）CHGAE 6）KIDLB 11）JF2. 1）constantly 2）impact 3）burden 4）Candidly 5）fulfillment 6）salaried7）resentment 8）assistance 9）perfect 10）suppress3. 1）successfully 2）resentment 3）security 4）necessity 5）advisable 6）access/accessibility7）athletic 8）maturity 9）emotional 10）effectivelyTranslation1）Because of an emergency，the doctor will not be available for several hours.2）How will taxes affect people with low incomes?3）My mother always told me that in the long run I would be glad that I didn't give up practicing the piano.4）The price of this book ranges from $10 to $20.5）It seems to me that you don't have much choice.6）Given their inexperience, they have done the job quite well.7）For such a big house the price is fairly low, but you'd got to take into consideration the money you will spend on repairs.8）Can we start with the discussion of problems arising from the last meeting?Part ThreeFURTHER Development1.STEP ONE1）ABACA 6）ACBCA 11）ACBCSTEP TWOAcross 1）shoplifter 4）thief 6）stole 7）too 8）fifty 11）witnessDown 1）sentence 2）out 3）robbery 5）into 6）son 8）fine 9）fist 10）owe STEP THREE1）creates 2）individuals 3）makes 4）combination 5）however 6）fall 7）responsible 8）which 9）difference 10）that 11）tempted 12）used 13）lowest 14）died 15）reducing 16）quick 17）reason 18）principle 19）minor 20）message2.EBFCAGDUnit 4Part onepreparation1. 1）film director 2）surgeon 3）flight attendant 4）pilot 5）cook/chef 6）conductor 7）lawyer 8）receptionist 9）policeman 10）butcher 11）doctor/physician12）auto-repairman 13）scientist/research worker 14）nurse3.Section A1）job 2）career 3）profession 4）tradeSection B1）pay 2）fee 3）salary/wages 4）incomeSection C1）job-seeker 2）employer 3）fire 4）interviewPart twopost-readingReading Comprehension1. 2）i）Most students choose fromii）professional occupations，is engaged in professional workiii）Young men lack interestiv）to express any choice of occupation3）i）Complacency ii）Defensive avoidance iii）Hypervigilance4）i）Study yourselfii）Write your career goals downiii）Review your plans and progressiv）you can start over5）ii）Job changes and career shifts occur2.1）TTFTF 6）TTTTF 11）TFVocabulary1. 1）acceptable 2）efficiency 3）implications 4）instability 5）rationalize 6）evaluation 7）foreseeable 8）invention 9）hastily 10）probability 11）professional 12）challenging 13）defensive 14）personality2. 1）in case 2）Every so often 3）resort to 4）talk over 5）start over 6）in reality 7）at stake 8）seized on 9）leading to 10）take stock of3. 1）programs 2）way 3）technical 4）both 5）provided 6）who 7）such 8）needed 9）opportunities 10）when 11）to 12）Completion 13）holding 14）early 15）hire 16）promote 17）up 18）educatingTranslation1）Several years ago，he underwent a major operation on heart.2）We estimated that it would take us a week to finish the task.3）I used to love photography, but now, I have no time to pursue any hobbies.4）You may love a person, but not necessarily marry him.5）Terrorists resort to violent measures to achieve their political aims.6）He said he would stay in the office this afternoon in case you should want to see him.7）Scientists have identified the gene leading to abnormal growth.8）There examples demonstrate how poorly some students write their resumes.Part ThreeFURTHER Development1. 1）ABCCC 6）ACBBC4.GDBHIUnit 5Part twopost-readingReading Comprehension1. 2）Her feeling before her teacher arrived.4）How she discovered words.B）learning the meaning of words and her reactionD）Her feelings and her new outlook on life5）ii）Job changes and career shifts occur2.1）A.One life refers to the life she led in the past, the other refers to the life she led after the teacher came.B.It refers to the very day when her teacher came to herC.Before the teacher came, she lived in darkness.Since the teacher came, she began the brand —new life.2）Because the day marked a new beginning in her life. That is a special day to her. On that day, Helen's teacher came and unfolded a new world before Helen.3）A."White darkness" here refer to a feeling of being lost, like a ship at sea almost unable of finding her way in white fog without sunshine. That is the true reflection of Helen's innerfeeling.B.It refers to the ship.4）She felt tense and anxious, waiting for something to happen with pounding heart.5）It refers to both the new doll and the big rag doll.6）The words and the objects the words refer to.7）Everything has it name.8）The living word here refers to the word "water" which denotes the wonderful cool thing flowing over Helen's hand. The living word awakened Helen's soul, so it became alive.9）Because great change happened in Helen's life after she discover the mystery of words, just like Aaron's rod, which had been a piece of dead wood, burst into flowers with God's love.3.When:She stood on the porch, waiting for the teacher for the come.the teacher tried time and again to teach her the connection between words and thingsshe felt the fragments of the broken doll at her feetshe finally discovered the mystery of language in the well-houseshe tried vainly to put the broken doll togetherHelen Keller's Feelings:interestedpleasant and proudpleasant/happyVocabulary1.Section A1）ABABC 2）BCCAASection B1）renewed 2）apply 3）persist 4）succeeded 5）drop 6）revealed 7）wonder 8）keenly 9）vainly 10）impressed2.1）unconsciously 2）expectant 3）eventful 4）immeasurable 5）imitation/imitating 6）continually 7）tenderness 8）impatientTranslation1）I became more anxious when I saw all the people walking to and fro outside the office.2）In time he will know who is his real friend.3）That scientist's experiment gave birth to a new medicine.4）Because of his illness, he had been shut in during mush of the winter.5）They would practice their oral English at the first opportunity.6）All the things she cherished would probably sweep away overnight.7）Towards the close of the semester, students are all busy with preparing for exams.8）We long for the departure of so cold winter.Part ThreeFURTHER Development1. 1）AABBC 6）BCCAB 11）CAUnit 6Part onepreparation2.Section A1）squirrel 2）owl 3）dolphin 4）tiger 5）monkey 6）dog 7）beaver 8）lion 9）penguin 10）ostrichSection B1）BCDCB 6）ADCCCPart twopost-readingReading Comprehension1. 1）Abnormal conditions2）aggressiveness3）came out of the jungle into a village and attacked a man4）becomes more aggressive than it would be in the wild5）would have stayed in the jungle and hunted for food in the customary way6）would be continually active，hunting in family groups7）free to wander8）Living conditions in crowded cities9）behave aggressively toward each other10）resentment and anger11）dropping a bomb from a plane12）their fellow creatures13）hit another person14）constructive activity and non-violent competition2.DCACDBVocabulary1.Verb Noun Adjective Adverb aggression aggressive aggressivelyviolent violentlybehaviorterritorialhostilitydisability disabledcomparison comparative/comparable comparatively/comparably destroy destructive destructivelyresentment resentful resentfullyconstruction constructive constructivelycompetition competitive competitivelyevident evidently2.peaceful trustunsatisfied abnormaldestructive publicenlarge discourage3. 1）survive 2）conflicts 3）available 4）likely 5）injuring 6）absorbed 7）competition 8）instinct 9）hesitated 10）similar4. ensure，population，characteristic，exhibit，defence，familiar，territory，case，minute，aggressive Translation1）She always behaves badly when her aunt pays a visit to her.2）We wouldn't have been able to finish the task on time if you hadn't help us.3）I warned him off going to the east coast for the reason of too many people there.4）The low piece of something doesn't necessarily mean that its quality is poor.5）Without anyone to turn to for help, it's difficult to make the right choice.6）The grief of losing his wife found expression in his music.7）Only if Peter takes part in the evening party will she go.8）I can only compare the experience to a nightmare.Part ThreeFURTHER Development1. 1）ABCAC 6）BABBCUnit 7Part onepreparation3.STEP TWOAcross：1）collection 5）modern 7）resort 8）clean 10）since 11）art 12）lane 13）sacred Down1）commercial 2）centre 3）industrial 4）mixture 6）drive 9）neverPart twopost-readingReading Comprehension1. A.1）My job2）My engagementB.3）To transform myselfC.4）I created, ready for change5）the usual influences in my life, whose approval was most important6）I structured my time7）experiment with new ways of being8）public commitments, back down9）systematically10）made changes when I return, while I was in ArubaD.11）going to transformative trips, my growth3.1）CCDAC 6）ACDBAVocabulary1.1）engagement 2）separating 3）influences 4）arranged 5）chosen 6）In case7）processed 8）changes 9）benefited 10）go on2. 1）end 2）booked 3）trapped 4）book 5）ended 6）appeal 7）trap 8）appeal 9）sample10）structure 11）value 12）structured 13）sampled 14）process 15）valued 16）process3. 1）A.emptied B.emptiness 2）A.terrified B.terrifying 3）A.entertaining B.entertainment 4）A.introductory B.introduction 5）A.employed B.employment6）A.transform B.transformation 7）A.convinced B.convincing 8）A.approvalB.approve9）A.isolates B.isolation 10）A.reinforcement B.reinforcedTranslation1）I don't expect putting on a play involved so much things.2）The most important thing is not what you say but what you do.3）In such circumstances, this result is the best that can be expected.4）It is not the first time that you have found yourself in such state.5）This difficulty challenges me to find out the answer.6）The new menace on the horizon is unemployment.7）We can express the same meaning in alternative ways.8）He slipped into the old habit of drinking.Part ThreeFURTHER Development1. 1）BABBC 6）BBABC 11）BCUnit 8Part onepreparation3.1）expected 2）conclude 3）account 4）nurture 5）argues 6）myth 7）predetermine 8）react 9）consequences 10）revolution 11）between 12）creaturePart twopost-readingReading Comprehension1. 2）A.same genes, same environmentB.physical, psychologicalC.weight, height, hair color, teeth,confident, graceful,personal appearance, considerable polish and ease,shy, self-conscious, quiet, charming or graceful manners3）What we can do is set by the genes, but what we actually do is largely determined by the environment.2.1）FFFFT 6）TFTVocabulary1.1）CACCA 6）BBB2. 1）resemble 2）alike 3）like 4）similar 5）same 6）Identical，same，alike3. 1）absolutely 2）eventually 3）obviously 4）Similarly 5）remarkably6）approximately 7）exclusively 8）actuallyPart ThreeFURTHER Development1. 1）BAAAB 6）CBBAC 11）BABC2.1）CCCBC 6）BCBBCUnit 9Part onepreparation1.1）violin、piano、drum、viola、cello、mouth organ、saxophone、classical guitar、electronic guitar、trumpet、accordion、electronic keyboard、harp、and some Chinese folk instruments like Erhu、Pipa、Guzheng、Xiao、etc.2）Bach、Chopin、Beethoven、Strauss、Brahms、Mozart、Schumann、Liszt、Xian Xinghai，etc.3）classical、modern、county、folk、jazz、blues、light、heavy metal、rock、pop、rap、ballad、sonata、symphony，ect.4）solo、duet、trio、quartet、chorus and choir.2.viola、string、bass、trio、quarter、duet、symphony、cello、violin、guitar3.1）widercrossingdream maker，heart breakerdriftersworldsamewaiting2）dreamy，empty，keep on，once，part，wonderful，happened，arms3）wisdom，darkness，whisper，broken-heated，parted，chance，cloudy，light，sound Part twopost-readingReading Comprehension1. 2）A.aggressive driving, relaxed and sleepyB.a.British Automobile Association,ii.the most dangerous and accident-prone groupb.i.making faster gear changes，accelerating more quicklyii.braking more abruptlyiii.i）find their attention wanderingii）the fast rock music was potentially lethaliii）noticing the fire engine，in my own thoughtsc.i.not hearing other vehiclesii.Alpha wavesiii.a feeling of well-being，even mini-sleep，horrific accidents3）A.a.on long boring roads，when traffic conditions are different or traffic is heavyb.may improve our driving，particularly in the high risk groupB.40% of minor road accidents，change a cassette or disc4）B.Application of Real-Time Intelligent Aid For DrivingC.takes advantage of radar to warn the driver when a collision is possibleD.a.a vibration through the accelerator pedal to warn the driver to slow downb.the engine cuts out，the hazard warning lights go on5）Music lovers should pay attention to safety while diving2.1）TFFTT 6）TFFTFVocabulary1..1）stimulate 2）distract 3）qualify/be qualified 4）induce 5）accelerate 6）soothe 7）overtaken 8）wandert 9）combine 10）commissioned2. 1）CDACA 6）CCATranslation1）I took the advantage of the fine weather to play tennis.2）You may even swim in the lake--if you feel inclined to.3）The excessively loud music brought on another headache to him.4）The careless are apt to make mistakes.5）The experiment resulted in a cure to a cancer.6）Comparatively，we are more concerned with work efficiency and product development. 7）According to doctors，operation could induce heart attack.8）I was qualified as a doctor at London University 30 years ago.Part ThreeFURTHER Development1. 1）CBBAA 6）BBCUnit10Part twopost-readingReading Comprehension1.1）surprised upon becoming 50 years old2）A.a.curiosityis better than everb.like a grain of sand by the sealimitations，capabilitiesB.can be filled with meaning only through love and work of one's choicea.loving，at nothingb.of becoming a reporter and than an authorC.a.The conflict of man with himselfI spend more time studying myself than anything elseb.are more alike differentbecause I except less from them tooD.that nothing interests me more than human natureFailures of communication between human being2.1）2）4）6）8）9）10）3.ACBCAB4.1）我可以注意力非常集中，其强度就好像用放大镜聚焦一束太阳光一样。

1、下载文档前请自行甄别文档内容的完整性，平台不提供额外的编辑、内容补充、找答案等附加服务。
2、"仅部分预览"的文档,不可在线预览部分如存在完整性等问题,可反馈申请退款(可完整预览的文档不适用该条件!)。
3、如文档侵犯您的权益，请联系客服反馈,我们会尽快为您处理(人工客服工作时间：9:00-18:30)。

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being aware Exercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) English Part Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. BSection III1) secretary 2) hard-working 3) efficient 4) private 5) army officer 6) help 7) fond 8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species5) oxygen 6) economic 7) conservation 8) valuable income 9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa￥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy with Section II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cards Practice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. French Practice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloud Part Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particular Exercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. disease Practice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stay Part Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs 14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking8. convenient9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winter Practice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to bethemselves 6. discipline 7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently15. read 16. exceptional 17. preparation 18. fully Section II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W 11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.W Exercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic 11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slower Exercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awards Practice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. TExercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorousYoussou N’Dour：not so heavy/ rhythmic/ sophisticated/unusual Practice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying 10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. T Exercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days8. give up9. stop trying 10. encounter risks 11. to be brave 12. shut 13. give 14. hold 15. wings16. learn 17. treasure 18. retrieved 19. race 20. journey Part Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black11. white 12. shaking 13. wet 14. sweet 15. delicious 16. angel 17. grave 18. nights 19. days 20. taste。