新编大学英语视听说教程3听力标准答案

合集下载

【精品】新编大学英语第三版视听说3听力答案(Unit1-Unit6)

Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问，应选C，请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √　2×3×4√Jack 1 √　4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11．FTFT2．South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1）import from abroad 2）sales manager 3）salary 4）sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√Ｃ×D√Ｅ×F√G×H√I√Ｊ2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√Ｂ×C√D√Ｅ×F√Ｇ×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1：Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2：1．1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√　5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1）a.whales and dolphinsb.birdsc. tigers2）a. meat oilb.handbags shoesc.furd.ivory2.TFTT。

【VIP专享】新编大学英语视听说教程3(第二版)_听力完整答案

~~~Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm 5) strength 6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private 5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed 10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. T Practice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. T Section III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species 5) oxygen 6) economic 7) conservation 8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa￥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11.plays/ real people/ real life/ emotional problem/ loyalty/ popular2.public speech / make themselves taller/ political one-sided3.soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11.learner/ teacher/ curriculum2.aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat8. clean9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4.vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently15. read 16. exceptional 17. preparation 18. fully Section II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W 11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.W Exercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11.restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorousYoussou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31.terrible rubbish / deafening/ stand2.slow-paced/ peaceful3.concentration on them4.dreamt of / afford5. dwell on the past / more freedom5.keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21.N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11.work, family, health, friends, spirit2.work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying 10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious16. angel 17. grave 18. nights 19. days 20. taste。

大学英语视听说教程3 听力答案

Unit 1 PersonalityPart 1 Listening, Understanding and SpeakingListening 11.FFTTFT2.1) outside world 2) at home 3)wave hello 4)bow 5)look straightinto the eyes 6)openly 7)look at my feet 8)shy and silent Listening 21. 1.sensitive independent2.good friend3.life people4.learning being aware2. BCADBListening 31. 1.ice-skating2. chemistry3.outgoing,bright,funny4.self-centered5.blond medium height6.runner-up2. TFTFFListening 41.1.Four2.Colleagues3.Teacher/Teaching4. Susan5. To go onholiday2.Paul DEJSusan BFMaria CHPeter AGIPart 2 Viewing, Understanding and Speaking1.CEDAB2.1) avoid confrontation 2) generally likable3) hide those traits 4) affectionate kind nature 5)stubbornness 6)worst reputation 7)revengeful and destructive 8)entertaining 9) tough and determined 10)intuition and protective nature 11)perfectionists 12) draw attentionPart 3 Video appreciation and Singing for Fun1.1. The lunar calendar2.Two trines3.Four trines2.1) who is very good with money2) who is easily angered3) display the utmost amount of energy4) longest life and good fortune5) with quick wit6) great common sense7) inspires leadership in others8) seductive and charming8)deep-thinking and very talented10) interesting and brave3. The tiger is courageous and aggressive, but is also sensitive when it comes to loved ones. They are known for their playful personality, and they are most compatible with the horse and the dog.As a horse, you are cheerful, popular, and you love the party. You come across as a warm individual, but sometimes you could be impatient. You are independent and you are also very skilled with money.As a dog, you are charismatic and a natural born leader. However, you could sometimes be a bit stubborn. You are very honest and you know how to keep a secret. When it comes to money, it doesn’t play much importance in your life.The rabbit is articulate and talented, and is known for their wonderful manners and is admired by many. The rabbit is also very trustworthy which will lead you to success in business.As a sheep, you strive for tranquility and harmony. And you are also very kind-spirited. When it comes to leadership, you could be quite timid. However, you always lead a very comfortable life.As a pig, you are very studious, and have tremendous inner-strength. You always go after your goals. You are quiet, however always well-informed. When it comes to your friends, you choose few. However, you are very trustworthy with the ones you do have.Part 4 Further Speaking and ListeningListening 11.1)upset 2)sensible 3)lecture 4)calm 5)strength 6)landed 7)swearing 8)perfectly 9)wildly 10) beeListening 21.BDAACCDCListening 31.CDEAF2.1 favorite way to relax 2. how to divide3. bad unripe3.stiff sore 5.fastening a basketball hoopListening 41.FTFFT2.1)understand the Scots’ English2) the friendliest people3) much nicer than4) English courtesy5) no views on the matterUnit 2 Myths and LegendsPart 1 Listening, Understanding and SpeakingListening 11.BABDC2.FTTFTListening 22.TFTTFFListening 31.1)stayed around 2)mouse catcher 3)rats and mice 4)got a paw 5)weak and thin 6)make a wooden paw 7)fastened it 8)grow sleek and fat 9)managed 10)peered out cautiously 11)seized it with 12) 18 miceListening 41.BDAAC2.FTTTFTFFPart 2 Viewing, Understanding and Speaking1.CEDBA2.1. in your hand used to belong to2. practicing with3.talked to each other Why not4.ask for find a way5.manage to his own love6.so foolishly jealous7.all three of them8.peacePart 3 Video appreciation and Singing for Fun2.1.invade2.shelter supply peace3.withdraw4.flag, hangedremember 5.secret, share 6.queenPart 4 Further Speaking and ListeningListening 11.BCBADA2.FFTTFListening 21. C D J2. A E G H3. B F I2. ABDCBDListening 3TFFFTFTTListening 41.associated2.railroad3. merchant4. dictionaries5.grasslands6.bring7.action8.One hundred days after his offer was made, the first herds arrived from the South.9.Soon there were at least 5,000cowboys bringing cattle up to Kansas from Texas.10. These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3 Social ProblemsPart 1 Listening, Understanding and SpeakingListening 11.BCDA2.FTFTFTListening 21.BDAD2.1)30s 2)male 3)190 4) long wavy 5)heavily built6)light red sweater 7)beardListening 31.BCAC2.1) love 2)together 3)mother 4)house 5)school6)friends 7)father 8)month 9)beach 10)callListening 41.1)stories 2)music 3)next door 4)in love with 5)secretary6)fights2.Celia: 124 Sara: 24 Jack: 14 Tom: 123Part 2 Viewing, Understanding and Speaking1.DCBEA2.TFFTTTTTFFPart 3 Video appreciation and Singing for Fun1.1. a central body transport vision2.access3. A race track4.slightly slower5.huge success2. 1.car movement cycling walking2. strategies quality of life3. visit the city4.investment design environment5. subtle design focusPart 4 Further Speaking and ListeningListening 11.FTFT2.1.South America pet food enough protein develop2. much more Asia Africa3.position natural resources gone down steady4. continued to rise5.getting richer and richerListening 21.1)the first few seconds 2)so thin 3) begins from another planet4) focused on 5) looked directly at 6)All around 7)until now8)despair, grief and disgust 9)started crying 10) who was sleeping peacefully2. 12458Listening 31)complained 2)work 3)chest 4)shocked 5) cold-blooded6)investigation 7)dealing8)He had mentioned his concern twice to the local official.9)Whenever this topic arose he always expressed strong views aboutdrugs.10) But it’s still too early to say this is related to the murder. Listening 41. 1.poverty crime2. drift better work pay3.resentment4.attractive education services5. a more positive attitudeUnit 4 Career PlanningPart 1 Listening, Understanding and SpeakingListening 11.245682.1.weaknesses2.similar abilities and interests, interest you, important andchallengingcation promotion educated persons4.parents, teachers, benefit, give careful thought. useful suggestions, personal qualities5.getting money, our future happiness, combinationListening 21.DDAB2.1)import from abroad 2)sales manager 3)salary 4)salescommission 5)travel in 6)experience 7)university 8)on a team Listening 31.1) choose their careers 2)avoid certain careers 3)differentprofessions4) impressions and prejudices 5)lawyers 6)accountants 7)scientists 8)most popular 9)least popular 10) ignorance2. TFTFTListening 41.CACBD2.1. occupation cool 2. catch, provide, fulfilling,3. media coming afteryou, make your own schedule, 4. have my pick of jobsPart 2 Viewing, Understanding and Speaking1.ABDF HIKLputer engineering puter programmer3.internship3.lecture competition puter programming skills5.impatient 7. constructive 8. medical research9. management 10. 3,600Part 3 Video appreciation and Singing for Fun1.ACDFH2.1.tremendous element of care2. where they’re from what kinds of contributions3. professional learning colleagues peers4. what makes their students tick5. relaxed care about them passionate developPart 4 Further Speaking and ListeningListening 11.1.100 million2. 35 403.seven eight4. office workers5. 8:00 4:006. eight- hour shifts7. Monday Thursday Saturday Sunday8. choose their own working hours freedom of choice happy with Listening 21.ADCADListening 3CBDCAListening 41.CABDB2.ADF, BF, ACEUnit 5 LanguagePart 1 Listening, Understanding and SpeakingListening 11.1. plays real people, real life, emotional problem, popular2. public speech, make themselves taller, political one-sided3. soft-soap, praise, kind2. FFTTTTListening 21.CAD2. 1. be understood easily2. necessary desirable,3. splendid4. prevents from achieving5. anxiety, effectListening 31.TFFFTT2.1. fairly good 2. ensure success3. natural, family relationship4. exposure5. visiting or telephoningListening 4AB2.1.Eggs Toast2.realistic, far better than, forgetting3. determined, personality, culture4. recite aloudPart 2 Viewing, Understanding and Speaking1.BACEDF2. 1. over long distances 2. look into it3. five times4. individualgroup 5 sex-specific, males, females, strangers 6. great apes7. teach, own kind 8. raised, held, look bigger9. round, tail-wagging 10. feeding, every directionPart 3 Video appreciation and Singing for Fun1.1.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.johned joined6.Siji…Siji Delaney Sinjin Delaney7.awful lawful8.spigot spiritPart 4 Further Speaking and ListeningListening 11.economic2.religious3. exist4. biologically5. 40,0006. cave7.Written8. humans were probably speaking thousands of years before that9. Even while we are reading or just thinking, we are in a sense “talking”10. Language is so much a part of human existence that we will be talking as long as we inhabit the Earth.Listening 21.DABBA2.1. permission apply for 2. application form website3.regular mail fax4. traveler’s checks credit cardsListening 31.BCE1)other native languages 2)two 3) more 4) of their choice 5)Spanish 6)Indians 7)English 8)German 9)FrenchListening 41.1. learner teacher curriculum2.curiosity, expectations, goals2. TFTFTUnit 6 Man and animalsPart 1 Listening, Understanding and SpeakingListening 11.BCDB2.TFFFTFListening 21.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACAListening 31.CABD2.1. crowding war water grass2. what is happening keep the number of horses low3. target practice where the horses were found4. gotten rid of stayListening 41.FTFTFTFF2.46Part 2 Viewing, Understanding and Speaking1.DABCC2.1)farm animals hold feed2) small pets toys 3. bury toss them out 4.real shame5. dangerous destructive bring diseases6. have point7. humanely limit 8. time, money warm place 9. isolated company 10. storm of debatePart 3 Video appreciation and Singing for Fun1.ADDBA CAB2.1.female collectively 2.not a moment3. infinite care4. picks up left to right5. struck smarter6. salt water lake, dock7. self-ware, non-human intelligencebelong in captivityPart 4 Further Speaking and ListeningListening 11.145672. ACCADListening 21.CBDDA2.257Listening 31.CADBB2.1. family holiday 2. 7-foot 18 stones3. stroking adjusting hisclothing 4. fractured skull, black eye, broken arm3.5. lose his love 6. cat 7. get-well cards presentsListening 41.1. a. whales and dolphins b. birds c. tigers2.a. meat oil b. handbags shoes c. fur d. ivory2.TFTT。

新编大学英语视听说book3Unit4听力答案及文本

新编大学英语视听说book3Unit4听力答案及文本1Unit 4Part OneListening IFor many of you this will be your last year at university and now is the time for you to begin thinking seriously about your future careers. In order to give you as much help as possible, I have quoted a list of questions that you ought to ask yourself.First, "Have I got a clear knowledge of my abilities as well as my interests?" Be honest about your weaknesses as well as your strengths. Take a really good look at yourself and give real thought to the kind of person you are, and what kind of person you want to be.Second, "Do I know the kinds of occupations in which people like myself tend to find success and satisfaction?" Talk to people who have similar abilities and interests and who are already in the careers that interest you. You can gain some idea of what they consider to be important and challenging in those careers. Watch these people at work.Third, "Have I weighed carefully the immediate advantages against the long-term prospects offered by the jobs I am considering?" Will the occupation you select give you satisfaction in the years to come? Realize now the importance of education in all fields, technical and professional. Remember that chances of promotion are usually given to educated persons—other things being equal.Fourth, "Have I talked with my parents, my teachers and my headmaster?" Remember they have a lot of experience that you can benefit from. They can help you think about the jobs. Theycan stimulate you to give careful thought to what you really want to do, and offer useful suggestions about how you might take full advantage of your personal qualities and qualifications.Last, "How do I regard my job? Is it just a means of getting money to do the things that I want to do? Is the work important to my future happiness? Is it a combination of both?"The above questions and their answers should give you some better ideas about how you should start planning your career. Your life-long job cannot be approached in any kind of haphazard fashion. It must be considered carefully, examined from every angle, and talked over with those who know you and those who can help you in any way.Exercise 12、4、5、6、8Exercise 21. weaknesses2. similar abilities and interests / interest you/ important and challenging3. education/ promotion/ educated persons4. parents/ teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II(Here's a dialog between a woman whose job is to help people find jobs and a man looking for a job.)Woman: Look. Here's a job that might interest you.Man: What is it? Are you sure? The last job interview you sent me off to was a disaster.Woman: Well, look. It says they want a sales manager, and it looks like it's a big international company. That'd be good. Youmight get to travel.Man: What kind of company is it, though?Woman: Um, let's see. Yes, it's a textile company that seems to import from abroad. They say the salary is really good. They operate a system of paying you a basic salary and then offering you a sales commission on top of that. They say it is high. And oh, look! They give you a car to travel round in. That's not bad, is it?Man: Um, do they say anything about experience?Woman: Um, let's see. No, they want someone young with ambition and enthusiasm. Oh yes, they want graduates, so that's OK. You've been to university. Now what else? Let's see.Man: There must be some catch.Woman: No, the only thing is you have to travel, but then that's what the company car's for. Oh, and you have to be able to get on well with other people because it says you have to be good on a team.Man: Um, perhaps I'll have a closer look at that one.Exercise 11. D2. D3. A4. BExercise 21. import from abroad2. sales manager3. salary4. sales commission5. travel in6. experience7. university8. on a teamListening IIIInterviewer: Some people feel that their jobs are misunderstood by others. Is that very common?Sociologist: Oh, absolutely. Most jobs or professions have an image or stereotype attached to them, and some of these are not realistic. The serious point is that young people choose their careers based on these false images, and they may even avoid certain careers which have a negative image. This can cause problems for the economy.Interviewer: Is there evidence of this problem?Sociologist: Yes, there was a recent survey of children's attitudes to different professions.Interviewer: How was this done? Children don't know much about jobs and professions.Sociologist: True. What the investigators wanted to get was children's impressions and prejudices. They gave the children twelve pairs of statements, one of the pair positive, and the other negative. Children were asked to say which of the statements was "most true" for each profession.Interviewer: For example?Sociologist: Well, for example, "Such and such a person is likely to be boring or interesting company."Interviewer: I see. What professions did they ask about?Sociologist: The list is long, but it included lawyers, economists, accountants, sales representatives, scientists and engineers.Interviewer: And the results?Sociologist: Well, they are striking, especially for engineerswho came out much worse than one might expect. About 90 percent of the children thought that engineering was a "dirty job", of "low status", and the engineer was more likely to take orders than to give them. The only other person they thought more likely to lose his job was the sales representative. But, there were good points too. Engineering was seen to be "interesting, well-paid work".Interviewer: Hmm, not a rosy picture.Sociologist: No, but it got better when children were asked what they thought of the engineer as a person. Most of them chose positive comments, but most thought the engineer was likely to be badly dressed.Interviewer: What about other professions? What were the most popular?Sociologist: Oh, the lawyers by far. Next came accountants and scientists as well as economists. The engineers and sales representatives were the least popular.Interviewer: Sounds like a sign of the times.Sociologist: Yes, but I think the most serious implication was the children's apparent ignorance of the importance of the engineer's role in society.Exercise 11. choose their careers2. avoid certain careers3.different professions4. impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. F3. T4. F5. TListening IVMegan: Tim, if you could pick any occupation in the world, what do you think would be a cool one?Tim: Well, truth be told, i think it would be pretty awesome to be a commercial fisherman. Megan: Fisherman! Why would you want to be a fisherman?Tim: Believe it or not, i’m really fascinated by the ocean. I like spending time in the ocean and I think if you go out on those boats and get away from the land, you really get in touch with the sea.Megan: Is it dangerous, though?Tim: Oh, it can be dangerous, for sure. You can get caught in storms. It can be rough sometimes.Megan: Do you get paid a lot of money?Tim: Not so much, but that is not necessarily vital. You know, you can work with nature. You can catch healthful food, provide for yourself, and I think that’s really fulfilling. How about you , Megan? What do you think would be a cool job?Megan: I think I would like to be a writer.Tim: Why is t hat? Lots of writers don’t succeed in making much of a living.Megan:Well, being a movie star would be exciting too, or a rock star, but the fame is overwhelming—too many peoplealways want to talk to you or want your autograph. I think as a writer, you are doing something you love without all that pressure or the media coming after you, and you can sort of make your own workk schedule and do it where you like. You can write in the countryside in a cabin, or you can write in the city wherever you please. So, I think it is a very flexible, rewarding job.Tim: Yeah, you’ve got to have the aptitude for it, though. Do you think you have what it takes?Megan: No, not yet. I’m a terrible writer. But anyway, if I could have my pick of jobs, I’d like to be a writer.Exercise 11. C2. A3. C4. B5. DExercise 21. occupation, cool2. catch, provide, fulfilling3. media coming after you, making your own work schedule4. have my pick of jobsPart 4Further ListeningListening IThere are at least 100 million workers in the Unites States. Most of them are on the job 35 to 40 hours a week. Their typical day includes seven to eight hours of work. Usually, they have a 15-minute coffee break in the morning and in the afternoon. But work schedules vary from job to job.White-collar workers—office workers and manyprofessionals—usually have "nine to five" jobs. They begin at 9:00 a.m. and finish at 5:00 p.m. Monday through Friday. "Blue-collar" workers—mechanics, electricians, and laborers—often work from 8:00 a.m. to 4:00 p.m. In many factories, blue-collar workers come to work in eight-hour shifts. Typically, these shifts start at 8:00 a.m., 4:00 p.m., and midnight. Finally, sales people and managers in retail stores work on Monday and Thursday nights, when the stores are open. Many retail workers also work on Saturdays, and some work on Sundays.These are the normal schedules for most American workers. However, many businesses now use a new system called "flex-time scheduling". Under this system, the employees choose their own working hours. Some people work from 8:00 to 4:00 five days a week. Some work from 9:00 to 5:00. Other people work 10 or 12 hours a day four days a week. Employees and managers are both happy with the system. The employees like the freedom of choice, so they work hard. The managers, of course, like the hard-working employees.What, then, is a typical work schedule? It depends on the job—and on the workers.Exercise:1. 100 million2. 35 to 403. 7 to 84. office workers, many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday ,Thursday, Saturdays ,Sundays8.choose their own working hours, freedom of choice , happy withListening IIMan: How long have you worked for AM-ADMEL, Gill?Woman: Only for a year. It's May now, isn't it? Yes, I joined last August in fact.Man: August in 1996.Woman: Yes.Man: What did you do before that?Woman: I used to work for a travel agency in London.Man: It was interesting, wasn't it?Woman: Not really. It was just secretarial work, rather like this job. And it wasn't too well-paid. But I took a secretarial course when I left school and I couldn't think what else to do.Man: So you went straight from school into a secretarial course, didn't you?Woman: Well, not quite. I left school when I was 16, in 1989, I think it was. And then I went to work in a hotel in Austria for a year, to learn some German.Man: Austria? Why Austria?Woman: I don't know really. Well, we used to go there on holiday quite often when we were younger, and, well, I like Austria actually. Anyway then I went back and did the secretarial course. That was a year's course.Man: And then you got the job at the travel agency I suppose.Woman: Yeah, that's right. That was in 1991.Man: So you were there for five years!Woman: Yes, it's awful, isn't it? Actually, I'm thinking of giving it all up to become a nurse.Man: Really?Woman: Well, I worked in a hospital in Twickenham during my last year at school. Just cleaning and helping to make bedsand so on. It was part of our Practical Careers training.Man: And you liked it?Woman: Yes, it was interesting.Exercise1. A2. D3. C4. A5. DListening IIIMan: Well, now then, one thing I'd like to ask is, er, exactly why you applied for the job. I mean, just looking at your application form, you're actually over-qualified...Woman: Yes, I thought you might ask that. Um, the thing is, in my present job, although I'm actually in charge of a small team and I have a lot of responsibility, it's largely a desk job with a lot of paperwork...Man: And you're not too keen on being stuck in an office all day?Woman: To be honest, no, I'm not. I much prefer being out on site where I can supervise things, and deal with problems as they occur. And this job should give me the kind of contact with other engineers, architects, builders and so on.Man: Mmm. You'd certainly have to do quite a lot of traveling in the local area, you know, visiting different sites. You do realize, though, that the starting salary isn't as good as the salary in your present job?Woman: Yes, I realize that, but um, it does say in the job advertisement that the promotion prospects are very good.Man: That's true, and er, as this is a new project that we'reworking on, we think there'll be a very good chance of fairly quick promotion, depending on performance, that is...Woman: Yes, of course. Well, you see, I've got very little chance of promotion in my present job.I mean it's a very small company and there's nowhere really for me to go; that's why I'm looking around for somewhere else.Exercise1. C2. B3. D4. C5. AListening IVDavid: Hi! You're listening to Radio Southwest, the best in the southwest for music andup-to-the-minute news. Sue's here. Hello, Sue.Sue: Hello, David.David: And we've got the Jobspot for you today. So, if you're looking for a new job, this could be the spot for you. So, let's have a look, and see what we've got today.Sue: Well, the first one we've got is a cook. That's in a large, busy restaurant, so it's very useful to have had experience in cooking. Must be a high school graduate and the pay is $12 an hour. So that's not bad, is it? The hours are good too. That's Monday to Friday, 3:00 p.m. till 6:00 p.m.David: Great. Thanks, Sue. So that's a cook. Now, how do you fancy working out of doors? How do you fancy being a gardener? So as long as you're fit and strong, and at least 16 years old, that'll suit you. The pay is $8 an hour. And the hours, Tuesday to Saturday, 8:30 a.m. to 5:00 p.m., you have to work on Sundayonce a month, but on Monday the Garden Center's closed. Now, the sort of work you'd be doing is potting, watering, things like that. So, how about applying for that? Pay, $8 an hour. Sue, what else have you got?Sue: Right, Dave. Well, from outdoors to indoors. We've got a word processor operator job here. This job might suit a woman with school-age children, because the hours are only 15 hours a week. It's a small, friendly office, and they require a high school graduate with two years' experience operating a computer. Pay is $9 per hour. So, there you go. That's a nice job in an office. If you fancy any of those jobs, give us a ring here on Jobspot at Radio Southwest. And now back to the music.Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACE。

新标准大学英语视听说第三册答案完整

Unit 1Inside ViewConversation 1Exercise 2:1. Janet is not going back to China.2. It is in the middle of summer.3. Janet is going to work for London Time Off, a website about London.4. Joe is Janet’s boss.5. Janet doesn’t know what she is going to do.6. Joe and Andy do not agree that New York is the greatest city. Exercise 3Conversation 2Exercise 55-6-2-3-8-7-4-1Exercise 61. don’t mind my asking2. he drives me crazy3. what do you mean by4. it’s the last thing5. we check out new events6. the musicians or the actors7. can I ask you something else8. we’ve got an interview to do9. supposed to be on his wayExercise 7B B B A A BOutside ViewExercise 24-5-1-3-2Exercise 3B C C A AExercise 51. b d f2. a e3. g4. cExercise 61. So that they can learn something about themselves2. It can lead to a higher self-consciousness3. It can lead to happiness4. A strengthening of the personality5. “Who am I as a person? Am I really happy?”6. He think students can get indications of happiness from teachers.7. Happiness scientists.8. They don’t write definitions on the board.Listening inPassage 1Exercise 2C D A BExercise 3:1. tolerant, rounded2. close to, stand up3. beauty, generosity4. an opportunity, beyond the one5. behaved, selfish6. pretend, see through7. arrived in, had to help8. difficult time, a huge amount ofPassage 2Exercise 61. Joan is an academic counsellor at Manchester University.2. She is talking to a presenter and callers for a radio program.3. It is important, because their choices of subject are likely to have an impact on their future careers.4. He wants to work in IT.5. Not at all.Exercise 71. strengths, weaknesses, personality, like, subjects, organized, confident, outgoing, a team, working alone.2. future careers, into a particular area of work, chosen field, related industries, leading3. vocational, graduates, high-flyers, career, practical, transferable, recruitmentUnit2Inside viewConversation 1Exercise 3:1.in Southwark, which is part of London2.About 120 years old3.it used to be raised three or four times a day4.not so often5.in the late 1980s and 1990s6.in the 1960sExercise 41.she’s really impressed.2.Because they couldn’t go under London Bridge.3.Just on this side of London Bridge.4.He remembers that many buildings were damaged from the war.5.They used to take you to the hospital because the water was so polluted.6.It is one of the cleanest city rivers in the world.Conversation2Exercise 6b b b d d aExercise 71.The thing about2.It’s amazing3.Let me see4.Anyway,where was I?5.You were telling me about6.That’s fascinating7.Let me thinkExercise 8b a b b bOutside viewExercise 24-3-6-1-5-2Exercise 31.where there is war2.go to school3.working in 157 countries4.has never known peace5.bringing medicine6.get an education7.40000 kids8.girls were not allowed9.50 percent10.running the school for 12 yearsExercise 41.d g2.e3.c4.f5.a6.bExercise 51. d2. a3. b4. b5. aListening inPassage1Exercise 21.her husband2. a church in the distance3.her favourite aunt(and uncle)4. a farm5.two(the speaker and her brother)6.about 147.20 yearsExercise 3c b a cd aPassage2Exercise 63-5-1-4-6-2Exercise 71.K(√)2.E(√)3.E(√)4.K(√)5.E(√)6.K(√)7.E(√)Exercise 81.Because he thought it would make him grown-up2.Because he was lying on the floor screaming and screaming3.Because she wanted to go home and she couldn’t get her coat on4.Because they used to fight (but actually,they’re just having fun)5.Because she had short blond hair.6.Because she had had some good times7.Because he wanted to get a job and earn moneyUnit3Inside viewConversation 1Exercise 21.He used to work in a theatre2.He moved the scenery between the acts in the play.3.She saw My Fair Lady4.To find out where Andy and Janet are ...or to check if they are going to be late.5.He’s a theatre critic.6.She has to check the sound levelExercise 31.Jan(√)2.Jan(√)3.A(√)4.A(√)5.Joe(√)6.A(√)7.Joe(√)8.A(√)9.Jan(√)10.Joe(√)Exercise 42 3 4 5 (√)Conversation 2Exercise 6b c d c aExercise 71.has just been to see2.Can you tell me something about it3.Tell me more about4.It sounds very unusual5.So it’s family entertainment6.did I do something wrong7.Did you remember to8.Hurry upExercise 8b b a a a aOutside viewExercise 21 5 7 9 10 (√)Exercise 31.most famous painting2.broke all the rules3.looking directly at4. a sense of movement5.indicated a real place6.what is she trying to say7.covered up one side of her face8.we’re the subject9.seemed happier10.the mystery about her11.line up between12.tell a storyExercise 41.A(√)2.S(√)3.S(√)4.S(√)5.A(√)6.S(√)7.S(√)8.A(√)10.A(√)11.S(√)12.A(√)Exercise 51.Her portraits and books both tell stories2.The character or performer of the images3.She is trying to capture a deeper essence of a person4.He uses a pinhole camera which requires a very long exposure5.She needs to work on the reflections in the water and the face of the boy6.He links them together with a string7.She tries to capture something about the soul,or essence ,of the person.8.It represents the process of decayListening inPassage1Exercise 21.The highlight was seeing the show Nanta2.It’s a live show :part theatre,part dance,part music.3.The music is a mixture of traditional Korean music,percussion and drums4.In 19975.Because it’s a non-verbal performance6.It’s set in a kitchen7.They use knives,dustbin lids and kitchen utensils8.Nanta means “random drumming” in Korean.Exercise 32 4 7 (√)Passage2Exercise 61.London2.New York3.1929,reopened 20065.Free6.20 US dollars7.8 euros8. 4.5 million9. 1 million10.211.3Exercise 7a c d c bUnit 4Inside viewConversation 1Exercise 21. They’re preparing to interview Janet’s friend.2. The interview is part of a background series to ethnic restaurants.3. The London Video Games Festival in Trafalgar Square.4. it’s very popular. About 100,000 people attended last year.5. They put up a huge tent where people could try out new video games.6. Because it’s very popular.Exercise 3B D A B BOutside view:Exercise 2B C B C D DExercise 31. wax and feathers2. got off the ground3. thrust, lift and control4. thrust5. the tail6. provide lift, control and thrust, and be light enough.Exercise 45-3-1-10-4-1-8-9-7-6Exercise 51. inventions2. develop and test3. helped them understand and study4. the shapes of different wings5. made the front steady6. controllable7. distance and duration8. 1,000 test flights9. flew the first powered airplaneListening inPassage 1Exercise 21. Work in office-based jobs2. People are not exercising their bodies and they are putting on weight.3. It is caused by long periods spent sitting at the computer.4. They ensure staff are sitting correctly at their computers and take breaks.5. It is caused by several factors: lack of natural air and light, having q lot of electronic devices and air-conditioning.6. They are installing better lighting and ventilation, increasing the number of plants and encouraging employees to take breaks.Exercise 31. 18%2. over 40%3. a/one fifth (20%)4. over a million5. roughly 30%Passage 2Exercise 6The true statements are: 2, 7 and 8.Exercise 71. the amount of the world’s farmland that is managed intensively2. the proportion of flowering plants that need to be pollinated in order to bear fruit3. the number of commercially grown crops that need honey bees4. the number of bees released by farmers in California to pollinate almond trees5. the time for a species of wild mango to bear fruit6. the time for a cultivated species of mango to bear fruitUnit 5Inside view:Conversation13.d g f a b c eConversation 25.1. so where do you call home?2. so how long has there been a Chinese community in London?3. And how did they make their living?4. And why did Chinatown move over here?5. And does it still feel like a traditional Chinese community?6.d b c b a7.1. I guess this is home2. how long has there been3. when the Chinese first came to4. they were also famous for5. at the start of the 20th century6. from all over London7. and does it still feel like8. along with the Chinese8. b b a b bOutside view2.1. it’s peaceful and quiet and just the place to relax.2. they fight3. during the mating season4. when they are on a crowded street or bus5. she’d be very angry and tell them to move.6. maybe throw a little sand in their face and make them move.7. move his towel next to them and start a conversation8. people can get a lot more aggressive9. she’s waiting until someone wants her parking space3. b c c d a5.1. he pulls into the parking space that the producer left2. because he was waiting first.3. anger management counseling4. because the radio in on5. a hearing problem6. he would beep the horn, roll down the window and shout very rude things at the person who took the space7. she would yell out of the window and tell them to move8. it is important for survival6.7-1-4-14-11-12-5-6-8-2-9-13-3-10inside view:passage 26.c b c c aUnit6Inside viewConversation12.she thinks it’s coldWoodA thatched roofA kind of dried grassThey standA report on the summer season at the Globe.Stratford-upon-Avon3.19971666There are some seats but most people stand MayAbout 130 kilometers4. d b c a cConversation26. The true statements are: 1,3,4,5 and 9.7.When was Shakespeare bornWhen did he dieWhen did he come to Londondon’t know exactlyWhat happened to him laterI reckon there are aboutWhat I think isI suppose it’s becauseI’m really stunnedI guess8. b a a bOutside view2.The true statements are : 1, 2 and 53. b c a b d4.I don’t like cyclingdo something goodsit on a couchand with two legslife on the roadthrow the bikeIt’s been differentPerforming marvelouslyListening in2.New YorkAfternoon15530 to 45 secondsnone57293.There were few injuriesCatch fireMade a successful landingTaking in waterhelped into the boatswere taken to hospitalsas a herowithout any engines6.PaulZoo keeperAl Goremaking people take climate change seriously GreenpeaceClaremum ,part-time accountantMelinda Gatesco-founding the Bill and Melinda Gates Foundation Save the Children7. The true statements are :1,5 and 7Unit7Inside viewConversation12. 5-3-2-6-1-43. c d d a b bConversation24.Topics actually mentioned are: steam engines, electricity, space rockets, satellites, computing, scientific experiments, agriculture, history of flight and telescopes.5.It’s got everything to do with science.She thinks it sounds fascinatingAt the museumShe tells him Andy and she are going to spend the night togetherJoe is surprised and confused6.Why is it so specialI suppose this ishave special exhibitions for kidsThe first thing you have to dowe’re really gonna stay the nightWhile you’re gettingWhere are you two off to7. b b b a bOutside view4. a d c a d5.areas of lifein our homescomputer-controlled housesadjust the temperaturegive new instructionsreact to matchTV and Internetoutside changesstop too much sun from entering turn the over onListening in2.carried out a two-month study About one in fourUnlike biscuits ,doughnuts Horizontally dunkingthe tea the fasterreleases up to ten times3.dunking biscuitsheld togetherabsorb liquidtravel throughhold the biscuitproducing a table6.By Peter:1,2,4,6 and 8By Louise:3,5 and 77. b b d a c a.Unit 8Inside viewConversation 12.1. most weekends2. every day of the week./ all week3. 10 am to 6 pm4. it gets pretty lively as people go to the pubs and restaurants all around.5. they sell pretty well everything6. it’s a famous club./ it’s one of THE great clubs in London7. to the electric Ballroom8. no, she doesn’t.3.the statements said by Janet are: 4 and 8the statements said by Andy are: 3,6 and 7the statements said by Joe are: 1,2 and 5conversation 27. a a b b blistening inpassage 26.Christmas: 1,6,8thanksgiving: 2,3,7Hogmanay: 4,57.1. because it’s a religious festival but she is not a religious person and so it doesn’t have that kind of meaning to her.2. it’s a good reason for families to get together, eat a lot of good food and five each other presents3. because it’s exciting to think that Father Christmas will come down the chimney and leave them presents4. it’s a time to give thanks for everything you have5. he says it’s probably as commercialized as Christmas.6. the shortest day of the yearUnit 9Inside viewConversation 12. The true statements are: 2 and 5.3. b c d c dconversation 25.1. royalty and landowners2. animals3. symbols taken from the bible4. objects5. places6. jobs7. myths and legends6.1. where was i2. you sound as if you know sth about3. where did I leave off4. ok, got you5. and let me see6. my mind’s gone blank7. if you’ll excuse me8. it was great talking to yououtside view2.photo 1: Elizabethphoto 2: Jamesphoto 3: Georgephoto 4: Victoria4. b b d a b clistening inpassage 12. 2-6-5-3-1-43.4.1. attractive, powerful, attractive, powerful2. to think of3. much too long4. meaning very small5. the best or the strongest6. most romantic lovers7. sound luxuriouspassage 27. the true statements are: 3, 4 and 68. c b c a dUnit 10Inside viewConversation 12.3.1. walking2. she doesn’t know anything about London3. some existed; some did not4. to have come to London with his cat to seek his fortune5. he was Lord Mayor of London four times6. we have no proof that he had a cat7. the ghosts of Londonconversation 25. b a b d c6.1. way to go2. that’s the way to do it3. l et’s hear it4. good for you5. thank you so much for your help6. couldn’t have done it7. we certainly did8. it’s extraordinary9. so what’s next7. b a b b aoutside view2. the true statements are: 1,3, and 43.1. in the present2. to trick people3. got sunscreen in his eyes4. eating bananas5. were descended from apes6. humans and animals4.1. the gravity reduction story and the Noah’s ark story2. the gravity reduction story3. the gravity reduction story was a hoax, the Noah’s Ark is tru e5.1. is based on a famous hoax2. would pass in front of3. at that moment4. the world was destroyed by a flood5. it is believed to be6. announced on the radio7. snow on the top of8. may or may not be Noah’s Ark9. we want to believe themlistening inpassage 12.1. d2. a, b, c3. e, f4. d5. c6. a7. e8. e3.1. the huge differences2. there was only darkness3. there was light’4. a small island5. Mother Earth6. a bird7. the sun, and the earth8. creation myth at allpassage 26. callers 1,3,4 and 5 believe in big cats7. b c d b d。

新编大学英语视听说教程第三册答案

Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-upExercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. Barbara Exercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourself1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving8. perfectly9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.d Exercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. d Practice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening II1. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. T1.south America; pet food; enough protein; develop2.much more; Asia; Africa3.position; natural resources; gone down; steady4.continue to rise5. getting richer and richer Practice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5. travel around in6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign languagePractice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy withSection II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. F1. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionPart TwoListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice one1. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice TwoExercise 1(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goalsExercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloud Part Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7. records8. agree9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。

新编大学英语视听说教程第三册标准答案

Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5.travel around in 6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice Two(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。

新编大学英语视听说教程第三册听力答案

Keys to the texts of book3Unit sixPart OneExercise 2 :1. d2. a3. b4.c5. c6. aExercise 31. farm animals; hold; feed2. small pets; toys3. buy; toss them out4. real shame5. dangerous; destructive ; bring diseases6. have a points7. humanely; limit8. time; money; warm place9. isolated; company 10. storm of debatePart TwoListening IExercise 11. b2. c3.d4. bExercise 21 T 2. F 3.F 4. F 5. T 6. TListening IIExercise 11.Her son.2. snake; crocodile3.quiet4.picky/particular Exercise 21. big2. dogs3.tiger4. bit5. cat6. friendly 6. eat 8. clear 9.wash 10.space 11. noisy 12. train 13. speak 14.keep 15. quietPart ThreePractice oneExercise 1(1,4,5,6,7,) yesExercise 21 a 2.b 3.c 4.a 5. dPractice TwoExercise 1(1,3)yesExercise 21. for free2.small donation3. 204. hundreds5. eat little6.50 7. animal shots 8. numerous shots 9. diseasesPractice ThreeExercise 11.c2.b3.d4.c5.aExercise 2(2,5.6.7) yesPractice FourExercise11 c 2.c 3. a 4.b 5. dExercise 21.crowding water; grass;2. what is happening; low3.targetpractice; over the area4. gotten rid of; stayPart Four Testing yourselfSection I1.f2. t3. f4. t5. f6. t7. t 8. f 9. f 10. tSection II1. a2. c3. d4. b5. b6. bSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5000 12. embarrassed 13. advertise the furs 14. export bans 15. importation 16.turtleKeys to the texts of book3Unit sevenPart OneExercise 2 :1. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery ;historic interest3. Summer ; too cold4. long history ; vast territory5. feed the monckys6. as many places as possible.7. you name it8.. host city ;ancient civilization; modern architecture9. city wall; treat yourselves 10.express train Part TwoListening IExercise 11 c 2. b 3. b 4. c 5. d 6. aExercise 21. SN 862 17:50 on July 112. SN863 15:10 on July 14 Listening IIExercise 1(B.C.F.G.H.I) yesExercise 2Part one 1.F 2. T 3.T 4.T Part two 1.F 2.F 3T 4.F Part three1.T2.T3.T .4.T5.FPart ThreePractice oneExercise 1Advantages: ADH ; disadvantages: EExercise 21 c 2.d 3.b 4. cPractice TwoExercise 11. seedypany3.shared4. noisy5. early6. private7. booking8. convenient9. restaurant 10.bathroomsExercise 21. T2. F3. T4. T5.6. TPractice ThreeExercise 11. Fuel2. Water3. Vehicles4. ClothesExercise 21.passing lorries 6. self-sufficient2.enough water 7. car repairs3.drinking 8. cost much4.vehicle 9. sweaters5.emergency 10. European winter Practice FourExercise1a. actress Bb. actress and author A1. a2.b3.b4. a5.b6. a7. a8. b Exercise 21.T . F 3. F 4. F 5. F 6. T 7. F 8.TPart Four Testing yourselfSection I1.F2.T3.T4. T5. FSection II My history teacher1. b2. c3. c4. c5. a6. dSection III1. d2. b3.c4. d5. aKeys to the texts of book3Unit eightPart OneExercise 2 :Section A5,7,1,4,6,3,2Section B1)F H I 2)A 3) C E J 4) B D G JExercise 31.passed out; in shock2. back and forth3. knows the reason why4. no doubt; living without her5. plays a great role6. brilliant boy7. very few cases8. deny; nature9. bright or not; should; CAN 10. thicker than; genetic relationship 11. react to; not to mention 12. hard decision; involvedPart TwoListening IExercise 11 F 2. F 3. T 4. F 5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed 8. language 9. young 10. alike 11. separated 12. apart 13. career 14. interestsListening IIExercise 11.b2.d3. a4. dExercise 2(1,4,6,8,10,11,12 ) yesPart ThreePractice oneExercise 1(3,6,9) yesExercise 21. six2. four3.1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice TwoExercise 11. 19212. fit the child3. ordinary schools4. adult conception5. BarbaraExercise 21. good being2.wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars 10. scholars 11. street cleanersPractice ThreeExercise 11. c2.b3. c4. bExercise 21 F 2. F 3. T 4. F 5. FPractice FourExercise11 a 2. c 3. d 4. aExercise 21.F2. T3.T4. T5.T6. TPart Four Testing yourselfSection I1.talent2.dancing3.creative4. early5. physical6. energy7. less8. curiosity9. particularly 10. cause 11. fundamental 12. meaning 13. superior 14. fluently 15. read 16. exceptional 17 preparation 18. fullySection II1.F2. T3. F4. F5. T6. F7. F8. TSection III1. c2. a3. c4. b5. dKeys to the texts of book3Unit NinePart OneExercise 2 :1. c2. c E3. .c4. w5. w 6 c 7. c 8. c 9.c 10. w 11. w 12. w 13. c 14. w 15. w 16. c 17. w 18. wExercise 31.prefer; old- fashioned2. as old as3. account for4.own; play; earn a living5. very proud of6. had the chance7. hills; small bridges; singing of birds8. full of energy9. holes; buttons; precise; notes 10.indirectly; individualistic 11. places great importance on 12. a universal languagePart TwoListening IExercise 11 restaurants, airports supermarkets; banks 2. attitudes; in the right mood ; a better feeling; the people around him; happy; work better 3. world war II 4. happy; calm ; a machine; kinds of music ; different times; faster ; slowerExercise 21. T2. F3.F4.T5.T6. F7. T8.FListening IIExercise 11.eases their minds; operations2. classical; instrumental Jazz;folk music 3. reduce tension; 50 male doctors; Mathematics ; 1. quickly 2. calmly 3. chosen for them 4. no music 5. the worst sleepyExercise 21. T2. F3.T4. F5. FPart ThreePractice oneExercise 11. b 19622.d 19633.a 19644. c 1970Exercise 21. their own style2. the nature3. sounds; experimented4. songs; records5. films ; awardsPractice TwoExercise 11. (1) (2) (3)2.(2) (1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the string5. manages the bowExercise 3.1. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice ThreeExercise 11. T2. T3. T4. F5. F6. F7. F8. TExercise 2。

新编大学英语视听说教程3听力标准答案

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly BExercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. T Exercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 T Practice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection II1. B2. B3. D4. B5. D6. A7. C 8. BSection III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. C Exercise 21. T2. F3. T4. T5. F6. F Listening III Exercise 11) stayed around 2) mouse catcher 3)rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7.F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. D Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7.F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction4) species5) oxygen 6) economic 7) conservation8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa￥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. F Exercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. B Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.T Exercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by10. sense11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. A Exercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debate Part TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.D Exercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory10. reduced11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. A Exercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages E Exercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathroomsExercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7)A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. D Section III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.T Part Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16.C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makesthe notes4. on the strings5. manages the bow Exercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. TExercise 2Bruce Springsteen: communicative, direct, exciting, simplerSting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorous Youssou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damaged Exercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. A Section II 1. C 2. B 3. D 4.A 5. B Section III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black11. white 12. shaking 13. wet 14. sweet15. delicious16. angel 17. grave 18. nights 19. days 20. taste。

新编大学英语视听说第3册听力原文和答案

新编大学英语视听说第3册听力原文和答案新编大学英语视听说第3册听力原文和答案Interviewer: Angela, you were born in Korea but you've been livingin Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I havetwo personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian. Interviewer: That sounds complicated. Could you explain what you mean?Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to whatis polite? Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person? Angela: Yes, but sometimes I don't know who I am.I am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others aregoing through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself.I don't like people doing things for me, or helping me, or giving me things.It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything. I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask. I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. Itmakes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Tom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing,bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different. Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in theMiss California Beauty Pageant two years ago. Well, you're probably not interested. Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!David: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile...He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot ofquestions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite agrown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and Ithink that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it?Have a good holiday, won't you?Barbara: Thanks.David: Bye.1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chairhe wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then youcan sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room inthe school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?A number of visitors to the UK, who had traveled throughout theBritish Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Somewere very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularlythe English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found Northcountry people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!" A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. Hehadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself. Statements:1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitora lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors.One day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was moresensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at thefly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not.I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee. Tom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. T aylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything. Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test. Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!(S1 = the first speaker; S2 = the second speaker; S3 = the third speaker; S4 = the fourth speaker)S1: In this week's edition of Up with People we went out into the streets andinterviewed a number of people. We asked a question they just didn't expect. Weasked them to be self-critical...to ask themselves exactly whatthey thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard.S2: Well...I...I don't know really...it's not the sort of question you ask yourself directly. I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretaryby the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street... Well...then I see someone a bit different. Yes...I'm different in my private life. And that's probably my mainfault I should say... I suppose I'm not coherent in my behavior. Myoffice is always in order...but my flat! Well...you'd have to see it to believe it.S3: Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4: Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven.I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.Mike: Hey, guys. Come and look. I've found an interesting Web siteon star signs. (The others come close to the computer and look at thestar signs on the screen.)Ted: Hey, that's interesting! What's your sign, Sam?Sam: I'm a Scorpio. What's yours, Ted?Ted: I have no idea. I've never really thought about that. Let's have a look. I was born on September 5. Oh, I'm a Virgo.Simon: And I'm a Libra.Sam: What do they say about Libra, Simon?Simon: (He reads.) You're a sociable, charming person. You go out of your way to avoid confrontation and do everything in your power to make your life an easy one. Although you're generally likeable, you can be changeable, superficial and critical. But you manage to hide thosetraits most of the time.Mike: Do you agree with that? Are you that type of person?Simon: What do you think? I think there is something in what it says.I am social and outgoing. But I am not changeable, am I? What's your sign, Mike?Mike: I'm a Taurus. Ah, what's yours, Lilly?Lilly: I'm a Cancer.Ted: Now let's look at Taurus.( He reads.) You're a patient,practical type. Goodpoints include your affectionate, kind nature, your trustworthiness and strength of character. Bad points include your possessiveness, self-indulgence and stubbornness. Do you think your character fits well?Mike: No, not at all. I'm not patient, and I'm not practical either.I am kind of quick-tempered and ambitious. That's definitely not me! But one thing is right: I AM stubborn.Simon: Sam, let me read yours. (He reads.) You are secretive, and sexy. You have theworst reputation in the zodiac. Scorpio has a dark side, which includes revengeful and destructive traits. Yet despite this, you can be the wittiest, kindest and most entertaining of all the signs.Sam: Oh, that can't be true! Are you sure you were reading Scorpio?Simon: Yes, of course! Look for yourself.Sam: But that's unfair! I have the worst reputation in the zodiac?!The others: (They all laugh and say.) Ha ha... Poor Sam!Sam: Who could believe such silly things! Really, I think I'm intelligent, humorous, and kind-hearted.Mike: Yes, but those are just your good traits. Don't forget about your bad ones! Sam: Come on! Oh, Lilly, we haven't looked at your sign yet. Eh, you are a Cancer, right? You want me to read yours?Lilly: No, thanks. I'm afraid you'll distort what's written there.Let me read it myself. (She reads.) To some people, you appear tough and determined, but that's just a "front" you put up to protect the real you, which is rather more sensitive and softer. You can be moody, touchy and irritable, but you make up for those negative traits with your kindness, great intuition and protective nature. That's not bad, is it?Simon: No. But what counts is not what it says, but how you really are, what you are actually like.Lilly: (She is a bit defensive.) What do you mean? What are youtrying to say aboutme?Simon: I think you are much nicer than what it describes.(Lilly smiles.)The other boys: Oh, Simon, don't sweet-talk her! We know what youare thinking. Ted: Hey, I haven't seen mine yet. Now it's my turn.Mike: Go ahead, Ted! Be our guest!Ted: It says: Virgo people like order in all things and are neat, clean and precise in their habits. Virgo people are perfectionists and they sometimes can be critical. They do not like to draw attention to themselves. Virgo people are modest, and careful about what they eat or drink.Sam: Do you have any objections to that?Ted: I think the description matches me quite well. I AM a perfectionist. I like things to be in order. Erm, I...I'm careful about what I eat and drink. But it doesn't mention my weak points.Lilly: Oh! And what are those?Ted: Well, sometimes I'm so careful I tend to waste a lot of time.I'm not very sociable, and I don't have many friends.Sam: I think everyone has some undesirable personality traits that could be improved. Don't you think we all could improve our personalities?Mike: I think we can. For example, my little sister was the youngest girl in our family. My parents loved her very much, but they spoiled her by giving her too much. She was at that time self-centered, selfish,aggressive, bad-tempered, and rude. Her personality didn'tchange any until she entered primary school. In school, she first acted as she did at home, and she couldn't make a single good friend. For a time, she was even isolated by her classmates. She complained to us, and finally understood her problem. From then on, she made every effort to get rid of her undesirable characteristics both at home and in school. Now she's in middle school and has turned into a popular girl.Lilly: In my opinion, our personalities are partly inherited and partly shaped by our home environment. As we all know, scientists have found that parents' personality traits can be seen in their children. Most children have some of their parents' personality traits.Mike: That's right. And our early home and school environment also has a big influence on the shaping of our personality. For instance,I've noticed that many children growing up in rich families may become wasteful, lazy, arrogant or cold. On the other hand, I've noticed that many children raised in poor families are hard-working, caring, sympathetic, and helpful.Sam: Does that mean you think we have to choose our parents wisely?(The others laugh.)2Mart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I hadthis good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I shouldsend her out there. It was a cold day in the fall. Well, she tookright off and away she went. But she didn't show up when it got dark. I began to worry about her. She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and seeif I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was this dog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth."There was an old man who had a daughter. He told his daughter thathe had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten themall up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen hisknife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papa invitespreachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled to the preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these."Jack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat.So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his woodenone. In no time, that cat had eighteen mice piled up in front of the mouse hole.Ken: Hey, Josh. Where did you get those comic magazines?Josh: When I went home last weekend, I found these old Superman magazines that my older brother had bought manyyears ago.Ken: You don't have time to read old comics. Why did you bring them here? Josh: In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken: Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh: When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken: How?Josh: Superman is an orphan who comes by rocket to Earth when his native planet explodes. He lands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work and consideration for others. As an adult, he migrates to a large city and defends Americans against evil.Ken: What else?Josh: Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken: But how does that relate to Superman?Josh: He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values ofhonesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken: I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh: OK.At one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs insteadof only for food. Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painfulstiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you."The spirits of the deer would run to the place where a deerhad been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If theanswer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again.Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them. When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a。

新编大学英语视听说教程3(十单元)听力标准答案

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being aware Exercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) English1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beard1. B2. C3. D4. AExercise 21.4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species5) oxygen 6) economic 7) conservation 8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America, pet food, enough protein, develop2. much more, Asia ,Africa3. position, natural resources, gone down, steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease7. education services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and pre judices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy with Section II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Exercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particular Exercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train 13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.T1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking8. convenient9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. T1. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13.careers 14. interestsListening II Exercise 11. B2. D3. A4. D1. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.W1. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic 11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slower Exercise 21. T2. F3. F4. T5.T6.F7. T8. F Listening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorousYoussou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. T Exercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying 10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 11. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 11. T2. T3. F4. F5.F6.T7.F8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days8. give up9. stop trying 10. encounter risks 11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious 16. angel 17. grave 18. nights 19. days 20. taste。

新编大学英语3视听说1~4单元听力原文与答案

Unit 1Part oneListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela:Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian. Interviewer: That sounds complicated. Could you explain what you mean? Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home. Interviewer: Do different cultures have different ideas as to what is polite? Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person? Angela: Yes, but sometimes I don't know who I am.Exercise 1 1. F 2. F 3. T 4. F 5. T 6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silent Listening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Exercise 1 1. sensitive/ caring independent / understanding 2. good friend 3. life people 4. learning being awareExercise 2 1. B 2. C 3. A 4. D 5. BPart Three More ListeningPractice oneTom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different. Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she hasa tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 1 1. ice-skating 2. chemistry 3. outgoing bright funny 4. moody self-centered 5. wavy blond medium height 6. unner-upExercise 2 1. T 2. F 3. T 4. F 5. F 6 TPractice twoDavid:Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl. David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.Exercise 1 1. Four 2. Colleagues 3. Teacher 4. Susan 5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter A G IPractice Three1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 1 1. Pedro energetic 2. Mr. Miller patient 3. Mr. Smith honest 4. Jake stubborn 5. Mrs. Duke creativePractice FourA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help. Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself. Statements1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitor a lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 1One day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection IITom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. T aylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. T aylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window,admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything. Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. T aylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. T om, I think you'd better get on with your homework!1. B2. B3. D4. B5. D6. A7. C8. BSection II I(S1 = the first speaker; S2 = the second speaker; S3 = the third speaker; S4 = the fourth speaker)S1: In this week's edition of Up with People we went out into the streets and interviewed a number of people. We asked a question they just didn't expect. We asked them to be self-critical...to ask themselves exactly what they thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard.S2: Well...I...I don't know really...it's not the sort of question you ask yourself directly. I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretary by the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street... Well...then I see someone a bit different. Yes...I'mdifferent in my private life. And that's probably my main fault I should say... I suppose I'm not coherent in my behavior. My office is always in order...but my flat! Well...you'd have to see it to believe it.S3: Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4: Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven. I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.1) secretary 2) hard-working 3) efficient 4) private 5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneListening IMart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I had this good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I should send her out there. It was a cold day in the fall. Well, she took right off and away she went. But she didn't show up when it got dark. I began to worry about her.She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and see if I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was this dog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth." Exercise 1 1. B 2. B 3. A 4. B 5. CExercise 2 1. T 2. F 3. T 4. T 5. F 6. TListening IIThere was an old man who had a daughter. He told his daughter that he had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten them all up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen his knife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papainvites preachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled to the preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these." Exercise 1 1. A 2. A 3. B 4. C 5. CExercise 2 1. T 2. F 3. T 4. T 5. F 6. FListening II IJack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat. So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his wooden one. In no time, that cat had eighteen mice piled up in front of the mouse hole.Exercise 11) stayed around 2) mouse catcher 3) rats and mice 4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat 9) managed 10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice oneKen: Hey, Josh. Where did you get those comic magazines?Josh: When I went home last weekend, I found these old Superman magazines that my older brother had bought many years ago.Ken: You don't have time to read old comics. Why did you bring them here?Josh: In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken: Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh:When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken: How?Josh: Superman is an orphan who comes by rocket to Earth when his native planet explodes. He lands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work and considerationfor others. As an adult, he migrates to a large city and defends Americans against evil. Ken: What else?Josh: Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken: But how does that relate to Superman?Josh: He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values of honesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken: I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh: OK.Exercise 1 1. B 2. A 3. A 4. C 5. DExercise 2 1. F 2. T 3. T 4. F 5.T 6 F 7. F 8.TPractice twoAt one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs instead of only for food.Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painful stiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you." The spirits of the deer would run to the place where a deer had been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If the answer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again. Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them. When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a cure for one of the diseases which animals had caused for mankind.This was the beginning of plant medicines from nature among the Cherokee Indians a long, long time ago.Exercise 1 1. C D J 2. A E G H 3. B F IExercise 2 1. A 2 .B 3. D 4.C 5. B 6. DPractice ThreeEvery March, a flock of buzzards returns to the town of Hinkley, Ohio. No one really knows how long this event has taken place, but according to local legend the annual buzzard migration began nearly 200 years ago with a massacre."The first legend of buzzards in Hinkley, Ohio, goes back to the Great Hinkley Hunt on December 24, Christmas Eve, in 1818. The local settlers deciding that the township needed to be made safe for their livestock, gathered together about 400 men and boys, with guns and clubs and completely surrounded the township of Hinkley."As the story goes, the townsfolk began marching toward the center of town, driving all the game in front of them, and killing virtually every wild animal they encountered. "The settlers took some of the deer and the wild turkeys for the holiday dinners, but left all of the other dead animals out in the snow. When spring came, the remaining dead animals attracted many buzzards, and since 1819 they've been coming back here in March."Hinkley locals have come to appreciate the buzzards' annual return. In mid-March, on Buzzard Sunday, they celebrate the birds' arrival with costumes, exhibits and songs. Exercise 1 1. B 2. D 3. C 4. D 5. AExercise 2 1. F 2. T 3. F 4. F 5.F 6. TPractice FourAlmost seven centuries ago, in Central Asia, there lived a great king called T amerlane. He was a mighty, powerful, conquering soldier, and his greatest ambition was that one day he would rule a massive empire stretching from the Atlantic Ocean in the west to the Pacific Ocean in the east. He made his imperial capital in the oasis city of Samarkand, which he planned to make the most beautiful city on earth. Many magnificent mosques were built and they were decorated with exquisite blue ceramic tiles on the outside, and with pure gold on the inside.Tamerlane, like the great oriental king that he was, had many wives, including a Chinese girl called Bibi Khanym. Now Bibi Khanym was the most beautiful of all T amerlane's wives, and she was also the youngest. She was his favorite wife and was deeply in love with him.In order to demonstrate her great love of Tamerlane, she decided to build a magnificent mosque to honor him, while he was away fighting in a distant war. She engaged the best architect, who designed for her the most magnificent mosque you could imagine. And then she found the best master builder, who began work immediately. But as the weeks and months passed by, the master builder began to fall in love with Bibi Khanym. She resisted all his advances, but at last he threatened to leave the mosque unfinished unless she allowed him to kiss her just once. Bibi Khanym wanted the beautiful mosque finished more than anything else. She was expecting Tamerlane to return any day. So at last she agreed to let the master builder kiss her, just once.But that was her terrible mistake, for so powerful was the master builder's love for BibiKhanym that when he kissed her he left a permanent mark on her face.King Tamerlane returned and saw the guilty mark on his wife's face. The master builder was executed immediately, and then, thinking that a woman's beauty can be a dangerous thing, Tamerlane ordered that from that day on all the women in the kingdom should never be seen in public without a veil to cover their face.Exercise 1 1. B 2 . C 3. B 4. A 5. D 6. AExercise 2 1. F 2. F 3. T 4. T 5.FPart Four Testing YourselfSection 1Long long ago, there was a pretty girl named "Red Riding Hood" because she was always wearing a red hood. One day her mother asked her to take some snacks to her grandmother because her grandmother was ill. Her mother told her, "Don't hang around on your way. Don't leave the main road."On her way, she saw a wolf. The wolf asked her where she was going and she told him that she was going to her grandmother's house. The wolf thought to himself how delicious she would taste. Red Riding Hood danced in the woods, picking flowers for her grandmother and forgetting what her mother had said to her.The wolf went to the grandmother's house and ate up the poor lady. Then he waited in the bed for Red Riding Hood.As Red Riding Hood came into the grandmother's house, she found her grandmother looked rather strange with very large ears, eyes, hands and mouth. And suddenly the wolf jumped out of the bed and devoured the little girl.。

新编大学英语视听说3纯答案版

新编大学英语视听说3纯答案版Unit 3Part OneExe 2 D C B E AExe 3 T F T T T T F F T FPart TwoListening IExe 1 BCDA Exe 2 FTFTFTListening IIExe 1 BDADExe 2 30s, male, 1.90, long wavy, heavy built, light red sweater, beardListening IIIExe 1 BCDA Exe 2 1, 4, 5, 7Part ThreePractice OneExe 1 1) natural riches, 2) desert, 3) extinction, 4) species, 5) oxygen, 6) economic development, 7) conservation, 8) valuable income, 9) awareness, 10) slow downExe 2 TFFTPractice TwoExe 1 FFTTExe 2 1) South America, pet food, enough protein, develop2) much more, Asia, Africa3) position, natural resources, gone down, steady4) continued to rise5) getting richer and richerPractice ThreeExe 1 1) the few seconds, 2) so thin, 3) beings from anotherplanet, 4) focused on, 5) looked directly at, 6) All around, 7) until now, 8) despair grief and disgust, 9) started crying, 10) who was sleeping peacefullyExe 2 1,2,3,5,8Practice FourExe 1 BCACExe 2 love, together, mother, house, school, friends, father, month, beach, callPart FourSection I complained about, work, got out of, on the ground, shocked, cold-blooded killing, investigation, drug dealing, concern, against, strong views, using drugs, too early, respectable, accused ofSection II CBABCSection III 1) overcrowded cities, 2) poverty, disease, 3) the drift, 4) registration, 5) resentment, 6) attractive, 7) education services, 8) rural lifeUnit 4Part OneExe 2 1) computer programmer, 2) computer engineering, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical, 9) management, 10) 3600Exe 3 1,2,4,6,8,9,11,12Part TwoListening IExe 1 2,3,4,5,7Exe 2 1)weaknesses, 2) similar abilities and interest, interest us, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combination Listening IIExe 11)Choose their careers, 2) avoid certain careers3) different professions, 4) children’s impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignoranceExe 2 TTFTFTPart ThreePractice OneExe 1 DDABExe 2 sales manager, salary, sales commission, a car, travel round in, experience, university, on a team Practice Two Exe 1 BBACCExe 2 1) 65 words, 2)90 to 100 words, 3) with languages, translate letters, answer the phone, foreign visitors, second foreign languagePractice ThreeExe 1 CABDBExe 2 1) ADF 2) BF 3) ACEPractice FourExe 1 1) sensitive extroverted, 2) kids, 3) doing a good job, 4) tolerance level, 5) patientExe 2 TFTFTPart FourSection I1.100 million2.35 to 403.7 to 84.Office workers, many professionals5.8:00 to 4:006.eight-hour shifts7.Monday, Thursday, Saturday, Sundays8.choose their own working hours, freedom of choice, happy withSection II DAACDSection III BCCDAUnit 5Part OneExe 2 BACEDFExe 31.over long distances2.look into it3.five times4.individual, group5.sex-specific, males, females, strangers6.great apes7.teach, own kind8.raised, held, look bigger9.round, tail-wagging10.feeding, every directionPart TwoListening IExe 11.plays, real people, real life, emotional problem, loyalty, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kindExe 2 FFTTTTListening IIExe 1 CADExe 21.be understood easily2.necessary, desirable3.splendid4.prevents, from achieving5.anxiety, effectPart ThreePractice OneExe 1 DABABExe 21.permission, apply for2.application form, Web site3.regular mail, fax4.traveler’s checks, credit cardsPractice TwoExe 1 2,3,5Exe 2 TFFTTTExe 3 1) other native languages, 2) two, 3) more, 4) of their choice, 5) Spanish, 6) Indians Spanish, 7) English, 8) German, 9) FrenchPractice ThreeExe11.learner, teacher, curriculum2.aptitude, expectations, goalsexe 2 TFTFTPractice FourExe 1 CCABExe 21.Eggs, Toast2.realistic, goals, far better than, forgetting3.determined, personality, culture,4.unusual, recite aloudPart FourSection Ireligions, exist, 40000, cave, moon, birth, records, agree, by, sense, ourselves, inhabitSection II FTFTFTTTSection III ADCDBAUnit 7Part OneExe 2 CBCDAExe 31.fun holiday2.natural scenery, historical interest3.summer, too cold4.long history, vast territory5.feed the monkeys6.as many places as possible7.you name it8.host city, ancient civilization, modern architecture9.city wall, treat yourselves10.express trainsPart TwoListening IExe 1 CBBCDAExe 2 SN 862 SN 86317:50, July 11 15:10, July 14 Listening IIExe 1 BCFGHIExe 21.FTTT2.FFTF3.TTTTFPart ThreePractice OneExe 1 ADHEExe 2 CDBCPractice TwoExe 1 seedy, company, shared, noisy, early, private, booking, convenient, restaurants, bathroomsExe 2 TFTTFTPractice ThreeExe11.Fuel2.Water3.Vehicles4.clothesExe 21.passing lorries2.enough water3.drinking4.vehicle5.emergency6.self-sufficient7.car repairs8.cost much, be costly9.sweaters10.European winterPractice FourExe 1 Occupations: B AHoliday: ABBABAABExe 2 TFFFFTFTPart FourSection I FTTTFSection II BCCCADSection III DBCDAUnit 9Part OneExe 2 CCCWWCCCCWWWCWWCWW Exe 31.prefer, old-fashioned2.as old as,3.account for4.own, play, earn a living5.very proud of6.1.5 billion, had the chance7.hills, small bridges, singing of birds8.full of energy9.holes, buttons, precise notes10.indirectly, individualistic11.places great importance on12. a universal languagePart TwoListening IExe 11.restaurants, airports, supermarkets, banks2.a. attitudes, in the right moodb. a better feeling, the people around himc. happy, work better3.a. World War II, happy, calmb. a machine, kind of music, different times, faster, slowerExe 2 TFFTTFTFListening IIExe 11.eases their minds, operations2.classical, instrumental jazz, folk music3. A. reduce tensionB. 50 male doctorsC. MathematicsD. quickly, calmly, chosen for them, No music, the worstE. sleepyExe 2 TFTFFPart ThreePractice OneExe 1 BDACExe 21.their own style2.the nature3.sounds, experimented4.songs, records5.films, awardsPractice TwoExe 1 1. 1) trumpet 2) piano 3) violin2. 2) piano 1) clarinetExe 2 picks the strings, as hard as, make the notes, on the strings, manages the bowExe 3 1) learn, 2) carry, 3) popular, 4) satisfying, 5) progress, 6) easiest, 7) less satisfying, 8) most difficult Practice ThreeExe1 TTTFFFFTExe 2 4, 1, 1, 1, 3, 2, 5, 4, 5, 1, 5, 5Practice FourExe 1 ABACAExe 2 TNTFTPart FourSection I TFFTFTTTSection II 2,4,7,8,10,12Section III falling, nice, cold, inside, raining, tears, happen, arms, fire, gone。

新标准大学英语视听说教程3答案

Unit 1 Outside view: Activity 3Row 1: 2 Row 2: 1 Row 3: 4 Row 4: 1 Row 5: 2 Row 6: 1 Row 7: 3Unit 1 Listening in: Passage 1 Activity 1Question 1 Key: c Question 2 Key: d Question 3 Key: aQuestion 4 Key: bUnit 1 Listening in: Passage 2 Activity 2Question 1 Key(s):(1) strengths (2) weaknesses (3) personality (4) like(5) subjects (6) organized (7) confident (8) outgoing (9) a team(10) working alone Question 2 Key(s):(1) future careers(2) into a particular area of work (3) chosen field(4) related industries (5) leadingQuestion 3 Key(s):(1) vocational (2) graduates (3) high-flyers (4) career (5) practical (6) transferable (7) recruitmentUnit 2 Outside view: Activity 2(1) where there is war(2) go to school(3) working in 157 countries/working in one hundred and fifty-seven countries(4) has never known peace(5) bringing medicine(6) get an education(7) 40,000 kids/forty thousand kids(8) girls were not allowed(9) 50 per cent/50 percent/fifty per cent/fifty percent(10) running the school for 12 years/running the school for twelve yearsUnit 2 Listening in: Passage 2 Activity 1 Correct order: 3, 6, 1, 4, 2, 5Unit 3 Outside view: Activity 2(1) most famous painting(2) broke all the rules(3) looking directly at(4) a sense of movement(5) indicated a real place(6) what is she trying to say(7) covered up one side of her face(8) we're the subject(9) seemed happier(10) the mystery about her(11) line up between(12) tell a storyUnit 3 Outside view: Activity 3Row 1: 2Row 2: 1Row 3: 1Row 4: 1Row 5: 2Row 6: 1Row 7: 1Row 8: 2Row 9: 1Row 10: 2Row 11: 1Row 12: 2Unit 3 Outside view: Activity 4Correct order: e, a, d, b, c, g, f, hUnit 4 Listening in: Passage 1 Activity 2Unit 5 Outside view: Activity 4 Correct order: 2, 10, 13, 3, 7, 8, 1, 9, 11, 14, 5, 6, 12, 4Unit 6 Outside view: Activity 2Unit 6 Listening in: Passage 2 Activity 1Question 1Key(s): zookeeperQuestion 2Key(s): Al GoreQuestion 3Key(s):making people take climate change seriouslyQuestion 4 Key(s): Greenpeace Question 5 Key(s): mum, part-time accountant Question 6 Key(s):Melinda GatesQuestion 7 Key(s):co-founding the Bill and Melinda GatesFoundationQuestion 8Key(s):Save the ChildrenUnit 9 Outside view: Activity 2Unit 9 Listening in: Passage 1 Activity 3Question 1 Key(s):(1) attractive, powerful(2) attractive, powerfulQuestion 2 Key(s): to think of Question 3Key(s): much too long Question 4 Key(s): meaning very small Question 5Key(s): the best or the strongest Question 6 Key(s): most romantic lovers Question 7Key(s): sound luxurious。

新编大学英语视听说3Unit1听力原文和答案

3Unit1 听新编大学英语视听说力原文和答案Unit 1Part OneListe ning IIn terviewer: An gela, you were born in Korea but you've been living in Canada for a long time, have n't you?An gela: Yes, I was 10 years old whe n my pare nts immigrated to Can ada and「ve bee n livi ng here for 20 years now.In terviewer: Do you thi nk that bel onging to two differe nt cultures has affected your pers on ality? Angela: Yes, definitely. There are times when I think that I have two pers on alities. Depe nding on where I am and who「m with, I'm Korea n or 「m Can adia n.In terviewer: That sounds complicated. Could you expla in what you mean?An gela: Well, grow ing up in Can ada whe n I was going to high school, for example, I was known as An gela to the outside world, and asSun-Ky ung at home. I would wave hello to my teachers, but bow to my pare nts' Korea n frie nds whe n they visited our home.In terviewer: Do differe nt cultures have differe nt ideas as to what is polite?An gela: Yes, defi nitely .In high school, I was expected to look straight in the eyes of my teachers and to talk ope nly with them. But whe n Korea ns spoke to me, I was expected to look at my feet and to be shy and sile nt.In terviewer: Do you thi nk that hav ing two pers on alities makes you a richer pers on?An gela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello4) bow5) look straight in the eyes of 6) ope nly 7) look at my feet8) shy and sile ntListe ning III am a very sen sitive pers on, and that's good to a poin t. I feel every one should be able to feel or un dersta nd what others are going through. But whe n you suffer and cry for people you don't know, or over a movie that s 6nly a story, then I think that's a little too sen sitive. That's the way I am.I am also a very in depe ndent pers on. I must do things by myself. I don't like people doing things for me, or helpi ng me, or givi ng me thin gs. It's not that I don't appreciate it. I just feel that whe n some one does somethi ng for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone any thi ng.I thi nk I would be a good frie nd. I would do almost any thi ng for some one I like; and I would share orgive any thi ng I have. I'm very cari ng and understanding. People trust me with their secrets, and they're right for doing so because I n ever tell others any secret that is told to me. 「m always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good.I find fun in almost everyth ing I do (except housework). I like to watch people, talk to them, and be around them. It makes no differe nee whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy lear ning and being aware of everyth ing and every one around me.Exercise 11. sen sitive/ cari ng in depe ndent / un dersta nding2. good friend3. life people4.learning being awareExercise 21. B2. C3. A4. D5. BListe ning IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Ci ndy and I are going ice-skati ng on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for n ext week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cin dy's sister, Kristi. We could double-date. She's really outgo ing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-ce ntered. She could n't stop talk ing about how great she was. I'm not sure if I can trust you, "Mr.Matchmaker".Bill: Oh come on. So I made a mistake last time. Ci ndy's sister is really differe nt.Tom: Well, what does she look like?Bill: Ah. Looks aren't importa nt. She has a won derful pers on ality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter tha n you are.Tom: Go on.Bill: She has a great figure, a nice complexi on, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kiddi ng. By the way, she was the runn er-up in the Miss California BeautyPagea nt two years ago. Well, you're probably notin terested.Tom: No, wait!Bill: Ah, just forget I ever men ti oned it.Tom: No, I'm in terested!Exercise 11. ice-skating2. chemistry3. outgoingbright funny 4. self-ce ntered5. blond medium height6. runn er-upExercise 21. T2. F3. T4. F5. FListe ning IVDavid: Barbara, before you go, could you tell me about these stude nts that are com ing into my class?Barbara: Oh, yes. Now, let me think, well,there's…er…Paul. He's a tall, slim lad with fair hair. Very frie ndly face, lovely smile... He's particularly good with group activities, and he's a very helpfulpers on to have in the class and very helpful with the other students. He speaks flue ntly, but does make a lot of mistakes! He does n't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susa n...Susa n. Now, she's very lively, quick, and very bright. She talks all the time but not always in En glish.David: What? Is she difficult or an ythi ng? Barbara: No…she's quite young but she does behave in quite a grow n-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very ni ce. She has dark hair and dark eyes.David: Right, well…are there any other girls in the class?Barbara: Y es, there is Maria. She's Susa n's sister.David: Y es.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has Ion ger hair tha n Susan. She's not quite as bright as her sister and I thi nk that makes her feel a bit in ferior really. Well, you know, she sulks a bit whe n she gets things wrong or she misun dersta nds you. But on the whole, a very sen sible girl.David: OK.Barbara: And the n there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brow n hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determ ined to lear n as much as possible. He asks quite difficult questi ons but he does n't mean to be n asty.David: Well, tha nks, Barbara. It's all up to me now, is n't it? Have a good holiday, won't you?Barbara: Tha nks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susa n5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter AG IFurther Liste ningListe ning IOne day, whe n Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sen sible tha n his wife, so he started to give her a lecture on the importa nee of always remai ning calm.Fi nally he said, "It's a waste of your stre ngth to get excited about small thin gs. Train yourself to bepatie nt, like me. Now, look at the fly that has just Ian ded on my no se. Am I gett ing excited or anno yed? Am I sweari ng or wavi ng my arms around? No. I'm no t. I'm perfectly calm."Just as he had said this, Mr. Smith started shouti ng. He jumped up and bega n to wave his arms around wildly and swear terribly. He could n't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sen sible 3) lecture 4) calm 5)stre ngth6) Ianded 7) swearing 8) perfectly 9) wildly 10) beeListe ning IITom: Oh, that Mr. Taylor. He is so bori ng! Mother: What do you mean?Tom: His less ons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darli ng?Tom: Yes, he gets angry very quickly.Mother: That does n't sound like Mr. Taylor at all!Tom: And do you know, he spe nds all the time look ing at his reflecti on in the win dow, admiri ng himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And con ceited! He thinks he knows everythi ng.Mother: Oh, Tom. Be reas on able. I'm sure you're exaggerati ng. Mr. Taylor seems such a ni ce, kind man.Tom: Well, he isn't. He is mea n and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I un dersta nd. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7.D 8. CListe ning III1. Pedro sleeps only six hours a ni ght. He goes to school full-time and works part-time in theafter noons. At ni ght he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of pers on is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The stude nts did n't un dersta nd. He had to repeat his less on and expla in the idea more slowly. Over the next few days heexpla ined and expla ined the less on un til almost the whole class un derstood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street n eighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom.Each one saw the chair he wan ted to sit on. Unfortun ately, it was the same chair. They both sat dow n at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, the n you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of pers on is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She faste ned a basketball hoop over the wastebasket. Now the stude nts love to practice throwing their paper into the basket. When they miss, they pick the paper up and try aga in. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. MillerD patie nt3. Mr. Smith E ho nest4. Jake A stubbor n5. Mrs. Duke F creative Exercise 21. favorite way to relax2. how to divide3. bad un ripe4. stiff sore5. faste ning a basketball hoop Liste ning IVA nu mber of visitors to the UK, who had traveled throughout the British Isles, were asked by a n ewspaper reporter what their impressi ons of the British people were. Here's a brief summary of what they thought.There were many differe nt opinions among those in terviewed: Some were very flatteri ng, others very critical. The distinction between the En glish and the British was n't always un derstood, but, onthe whole, it seemed that the Scots were very popular with visitors. They were thought to be very frie ndly, eve n though one Dutch visitor con fessed she'd found it hard to un dersta nd their En glish.A great n umber found the British gen erally reserved, particularly the En glish, although one Australian visitor called the English "the frien dliest people in the world and most hospitable". But she did admit that speaking the same Ian guage was a great help.Some Asia n bus in essme n, who had traveled widely throughout En gla nd, said quite ope nly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much ni cer", one of them said, with a playful smile on his face, "By much ni cer I mea n much more like us!"A few con ti nen tals praised "En glish courtesy", but the majority found it dish on est and dull."Yo u're forever say ing 'please' and 'sorry' whe n you don't feel pleased or sorry," one expla in ed.A young stude nt from South Africa had no views on the matter. He had n't met anyEn glishme n, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scots' English 2) the friendliest people 3) much nicer than 4) En glish courtesy 5) no views on the matter/ nocomme nts on the matter。

1、下载文档前请自行甄别文档内容的完整性，平台不提供额外的编辑、内容补充、找答案等附加服务。
2、"仅部分预览"的文档,不可在线预览部分如存在完整性等问题,可反馈申请退款(可完整预览的文档不适用该条件!)。
3、如文档侵犯您的权益，请联系客服反馈,我们会尽快为您处理(人工客服工作时间：9:00-18:30)。

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being aware Exercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) English Part Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species5) oxygen 6) economic 7) conservation 8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America, pet food, enough protein, develop2. much more, Asia ,Africa3. position, natural resources, gone down, steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyer s6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy with Section II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particular Exercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train 13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking8. convenient9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winter Practice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13.careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slower Exercise 21. T2. F3. F4. T5.T6.F7. T8. F Listening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorousYoussou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen8. arms9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. T Exercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying 10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. T Exercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days8. give up9. stop trying 10. encounter risks 11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious 16. angel 17. grave 18. nights 19. days 20. taste。