汇编大学英语视听说3Unit1听力原文和标准答案
【精品】新编大学英语第三版视听说3听力答案(Unit1-Unit6)
Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问，应选C，请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √ 2×3×4√Jack 1 √ 4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11．FTFT2．South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1）import from abroad 2）sales manager 3）salary 4）sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√Ｃ×D√Ｅ×F√G×H√I√Ｊ2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√Ｂ×C√D√Ｅ×F√Ｇ×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1：Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2：1．1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√ 5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1）a.whales and dolphinsb.birdsc. tigers2）a. meat oilb.handbags shoesc.furd.ivory2.TFTT。
新标准大学英语视听说教程3Units1-10答案
3
Exercise 7
1 The thing about
2 It’s amazing
3 Let me see
4 Anyway where was I
5 You were telling me about
6That’s fascinating
3 It is important, because their choices of subject are likely to have an impact on their future
careers.
4 He wants to work in IT.
5 Not at all. (In Britain each university has a different mixture of courses; some courses can only
New Standard College English(Book 3)
Unit 1
Inside View
Conversation 1
Exercise 1
1 Janet is a Chinese student in England.
2 She studies at the University of Oxford.
2 Because he was lying on the floor screaming and screaming.
3 Because she wanted to go home and she couldn’t get her coat on.
4 Because they used to fight (but actually, they’re just having fun).
新标准大学英语视听说教程3 Units 1-10答案
New Standard College English (Book 3) Unit 1Inside ViewConversation 1Exercise 11 Janet is a Chinese student in England.2 She studies at the University of Oxford.3 She is in London.4 Probably she is visiting her friends or doing a tour around London.5 I can see Tower Bridge and the Houses of Parliament.6 She is talking to her friends.Exercise 21 Janet is not going back home to China. (Because she wants to work in London during the long summer holiday and find out what it’s lik e to live in this busy and lively city.)2 It is in the middle of summer.3 Janet is going to work for London Time Off, a website about London.4 Joe is Janet’s boss.5 Janet doesn’t know what she is going to do.(Because it is her first day working there.)6 Joe and Andy do not agree that New York is the greatest city. (Andy thinks London is.)Exercise 3Exercise 41 Janet wants to find out what the busy and lively city of London is like.2 Today.3 Joe doesn’t agree with Andy. (But they argue in a joking way.)4 It is not as great a city as London.5 She thinks London is probably the greatest city in the world.Conversation 2Exercise 55-6-2-3-8-7-4-1Exercise 61 don’t mind my asking2 He drives me crazy3 What do you mean by4 It’s the last thing5 we check out new events6 the musicians or the actors7 Can I ask you something else8 we’ve got an interview to do9 supposed to be on his wayEveryday English1 (b)2 (b)3 (b)4 (a)5 (a)6 (b)Outside ViewExercise 24-5-1-3-2Exercise 31 (b)2 (c)3 (c)4 (a)5 (a)Exercise 51 Bjoern (b), (d), (f)2 Wolfgang (a), (e)3 Pascal (g)4 Yosma (c)Exercise 61 So that they can learn something about themselves2 It can lead to a higher self-consciousness.3 It can lead to happiness.4 A strengthening of the personality.5 “Who am I as a person? Am I really happy?”6 He thinks students can get indications of happiness from teachers.7 Happiness scientists.8 They don’t write definitions on the board.Listening inExercise 21 (c)2 (d)3 (a)4 (b)Exercise 31 tolerant; rounded2 close to; stand up3 beauty; generosity4 an opportunity; beyond the one5 behaved; selfish6 pretend; see through7 arrived in; had to help8 difficult time; a huge amount ofExercise 61 Joan is an academic counselor at Manchester University.2 She is talking to a presenter and callers for a radio program.3 It is important, because their choices of subject are likely to have an impact on their future careers.4 He wants to work in IT.5 Not at all. (In Britain each university has a different mixture of courses; some courses can only be found in a few universities.)Exercise 71 strengths; weaknesses; personality; like; subjects; organized; confident; outgoing; a team; working alone2 future careers; into a particular area of work; chosen field; related industries; leading3 vocational; graduates; high-flyers; career; practical; transferable; recruitment Unit 2Inside ViewConversation 1Exercise 2The true statements are: 2, 3 and 5.1 Andy mentions the names of two bridges, not one.4 Andy saw it go up when he was a child.6 It is one of the cleanest city rivers today, although it was very polluted in the past.Exercise 31 In Southwark, which is part of London2 About 120 years old3 It used to be raised three or four times a day4 not so often5 In the late 1980s and 1990s6 In the 1960sExercise 41 She’s really impressed.2 Because they couldn’t go under London Bridge.3 Just on this side of London Bridge.4 He remembers that many buildings were damaged from the war.5 They used to take you to the hospital because the water was so polluted.6 It is one of the cleanest city rivers in the world.Conversation 2Exercise 61-(b) 2-(b) 3-(b) 4-(d) 5-(d) 6-(a)Exercise 71 The thing about2 It’s amazing3 Let me see4 Anyway where was I5 You were telling me about6 That’s fascinating7 Let me thinkEveryday English1-(b) 2-(a) 3-(b) 4-(b) 5-(b)Outside ViewExercise 24-3-6-1-5-2Exercise 31 where there is war2 go to school3 working in 157 countries4 has never known peace5 bringing medicine6 get an education7 40,000 kids8 girls were not allowed9 50 per cent10 the mystery about her for 12 yearsExercise 41 (d), (g)2 (e)3 (c)4 (f)5 (a)6 (b)Exercise 51 (d)2 (a)3 (b)4 (b)5 (a)Listening inExercise 21 her husband2 a church in the distance3 her favourite aunt (and uncle)4 a farm5 two (the speaker and her brother)6 about 147 20 yearsExercise 31 (c)2 (b)3 (a)4 (c)5 (d)6 (a)Exercise 63-5-1-4-6-2Exercise 7Exercise 81 Because he thought it would make him grown-up.2 Because he was lying on the floor screaming and screaming.3 Because she wanted to go home and she couldn’t get her coat on.4 Because they used to fight (but actually, they’re just having fun).5 Because she had short blond hair.6 Because she had had some good times.7 Because he wanted to get a job and earn money.Unit 3Inside ViewConversation 1Exercise 21. He used to work in a theatre.2. He moved the scenery between the acts in the play.3. She saw My Fair Lady.4. To find out where Andy and Janet are … or to check if they are going to be late.5. He’s a theatre critic.6. She has to check the sound level.Exercise 3Exercise 4True statements are 2, 3, 4 and 5.Conversation 2Exercise 61 (b)2 (c)3 (d)4 (c)5 (a)Exercise 71. has just been to see2 Can you tell me something about it3 Tell me more about4 It sounds very unusual5 So it’s family entertainment6 did I do something wrong7 Did you remember to8 Hurry upExercise 81-6bbaaaaOutside ViewExercise 2The true statements are: 1, 5, 7, 9 and 10.Exercise 31 the most famous2 broke all the rules3 looking directly at4 a sense of movement5 indicated a real place6 what is she trying to say7 covered up one side of her face8 we’re the subject9 seemed happier10 the mystery about her11 line up between12 tell a storyExercise 4Exercise 51 Her portraits and books both tell stories.2 The character or performer of the images.3 She is trying to capture a deeper essence of a person.4 He uses a pinhole camera which requires a very long exposure.5 She needs to work on the reflections in the water and the face of the boy.6 He links them together with a string.7 She tries to capture something about the soul, or essence, of the person.8 It represents the process of decay.Listening inExercise 21 The highlight was seeing the show Nanta.2 It’s a live show: part theatre, part dance, part music.3 The music is a mixture of traditional Korean music, percussion and drums.4 In 1997.5 Because it’s a non-verbal performance.6 It’s set in a kitchen.7 They use knives, dustbin lids and kitchen utensils.8 Nanta means “random drumming” in Korean.Exercise 3The true statements are: 2, 4 and 7.1 Nanta is a mixture of traditional Korean with a Western style performance.3 They are preparing food for a wedding reception.5 They give cooking lessons to the manager’s nephew, not to the manager.6 They are totally involved but they don’t throw food.8 They have already appearedat the Edinburgh Festival.Exercise 6Exercise 71 (a)2 (c)3 (d)4 (c)5 (b)Unit 4Inside viewExercise 21 They’re preparing to interview Janet’s friend.2 The interview is part of a background series to ethnicrestaurants.3 The London Video Games Festival in Trafalgar Square.4 It’s very popular. About 100,000 people attended last year.5 They put up a huge tent where people6 Because it’s very popular.Exercise 31-5 bdabbExercise 61 The rise of e-book readers.2 That you’ll never run ou t of things to read.3 He complains that someone is using a mobile phone and he is picking up the signal in the other studio.4 She feels that she keeps making a mess of things.5 A report on how technology is changing so fast.6 Because Joe started the recording before Andy had time to adjust the sound level. Exercise 71 They’re not really like2 But the trouble is3 the great thing about them is4 there is nothing quite like5 more text messages than6 it’s my fault7 Just ignore himOutside viewExercise 21-6 bcbcddExercise 31 wax and feathers2 got off the ground3 thrust, lift and control4 Thrust5 the tail6 provide lift, control and thrust, and be light enoughExercise 45-3-2-6Exercise 51 inventions2 develop and test3 helped them understand and study4 the shapes of different wings5 made the front steady6 controllable7 distance and duration8 1000 test flight9 flew the first powered airplaneListening inExercise 21 Work in office-based jobs.2 People are not exercising their bodies and they are putting on weight.3 It is caused by long periods spent sitting at the computer.4 They ensure staff are sitting correctly at their computers and take breaks.5 It is caused by several factors: lack of natural air and light, having a lot of electronic devices and air-conditioning.6 They are installing better lighting and ventilation,increasing the number of plants and encouragingemployees to take breaks.Exercise31 18 per cent2 over 40 per cent3 a/one fifth (20 per cent)4 over a million5 roughly 30 per centExercise 6The true statements are 2, 7 and 8Exercise 71 the amount of the world’s farmland that ismanaged intensively2 the proportion of flowering plants that need to be pollinated in order to bear fruit3 the number of commercially grown crops that need honey bees4 the number of bees released by farmers in California to pollinate almond trees5 the time for a species of wild mango to bear fruit6 the time for a cultivated species of mango to bear fruitUnit 5Inside ViewExercise 21. It is Cantonese food.2. Indian and Chinese restaurants.3. They want to know about life in Chinatown and a bit of background and history.4. There are very few who actually live there.5. It’s much smaller.6. There are only three or four streets.Exercise 31. (d)2. (g) 3 (f) 4 (a) 5 (b) 6 (c) 7 (e)Exercise 5□1 So where do you call home?☐ When did your family move to London?□3 And how did they make their living?☐ Did your grandparents work in Chinatown too?□2 So how long has there been a Chinese communityin London?□4 And why did Chinatown move over here?☐ Can most British-born Chinese speak Chinese?□5 And does it still feel like a traditional Chinesecommunity?☐ How do you celebrate Chinese New Year in London?☐ Which is the best Chinese restaurant in Chinatown?Exercise 61 (d)2 (b)3 (c)4 (b)5 (a)Exercise 7(1) I guess this is home(2) how long has there been(3) When the Chinese first came to(4) they were also famous for(5) At the start of the 20th century(6) from all over London(7) And does it still feel like(8) along with the ChineseEveryday EnglishExercise 81 (b)2 (b)3 (a)4 (b)5 (b)Outside ViewExercise 21. It’s peaceful and quiet and just the place to relax.2. They fight.3. During the mating season.4. When they’re on a crowded street or bus.5. She’d be very angry and tell them to move.6. Maybe throw a little sand in their face and make them move.7. Move his towel next to them and start a conversation.8. People can get a lot more aggressive.9. She’s waiting until someone wants her parking space. Exercise 31 (b)2 (c)3 (c)4 (d)5 (a)Exercise 51. He pulls into the parking space that the producer left.2. Because he was waiting first.3. Anger management counselling.4. Because the radio is on.5. A hearing problem.6. He would beep the horn, roll down the window and shout very rude things at the person who took the space.7. She would yell out of the window and tell them to move.8. It is important for survival.Exercise 67-1-4-8-2-9-13-3-10Listening InExercise 2•synergy: performance of effective groups > sum of individuals.•1930s Elt on Mayo discovered “Hawthorne effect”:* Being in a study improves productivity regardless of other factors.* Personal identity, self-esteem and social context in which group works improve performance.• 1960s Tuckman described stages of a group.* 1 Forming: Individuals get to know each other.* 2 Storming: Individuals share ideas and creative energy.* 3 Norming: Group identity forms.* 4 Performing: Group works together.Exercise 31 (c)2 (a)3 (e)4 (g)5 (f)6 (d)7 (h)8 (b)Exercise 61 (c)2 (b)3 (c)4 (c)5 (a)Exercise 71. Over 250 people died.2. 36 new homes were rebuilt.3. It is two square metres.4. 30 per cent of the cost of the building or rebuilding their home is needed.Unit 6Inside ViewExercise 21. She thinks it’s old.2. Wood.3. A thatched roof.4. A kind of dried grass.5. They stand.6. A report on the summer season at the Globe. (As schools have terms, theatres have seasons.)7. Stratford-upon-Avon.Exercise 31. 19972. 16663. There are some seats but most people stand.4. May.5. About 130 kilometers.Exercise 41 (d)2 (b)3 (c)4 (a)5 (c) Exercise 6The true statements are: 1, 3, 4, 5 and 9. Exercise 7(1) when was Shakespeare born(2) when did he die(3) when did he come to London(4) don’t know exactly(5) what happened to him later(6) I reckon there are about(7) What I think is(8) I suppose it’s because(9) I’m really stunned(10) I guessExercise 81 (b)2 (a)3 (a)4 (b)Outside ViewExercise 2The true statements are: 1, 2 and 5.Exercise 31 (b)2 (c)3 (a)4 (b)5 (d) Exercise 4(1) I don’t like cycling(2) do something good(3) sit on a couch(4) and with two legs(5) life on the road(6) throw the bike(7) It’s been d ifferent(8) performing marvellouslyListening InExercise 21. New York2. afternoon3. 1554. 30 to 45 seconds5. none6. 577. 29Exercise 31. there were few injuries2. catch fire3. made a successful landing4. taking in water5. helped into the boats6. were taken to hospitals7. as a hero8. without any enginesExercise 6Paul1. zoo keeper2. Al Gore3. making people take climate change seriously4. GreenpeaceClare5. mum, part-time accountant6. Melinda Gates7. co-founding the Bill and Melinda Gates Foundation8. Save the ChildrenExercise 7The true statements are: 1, 5 and 7.Unit 7Inside viewExercise 25-3-2-6-1-4Exercise 31 (c)2 (d)3 (d)4 (a)5 (b)6 (b) Exercise 51 It’s got everything to do w ith science.2 She thinks it sounds fascinating.3 At the museum4 She tells him Andy and she are going to spendthe night together.5 Joe is surprised and confused.Exercise 61 Why is it so special2 I suppose this is3 have special exhibitions for kids4 The first thing you have to do5 we’re really gonna stay the night6 While you’re getting7 where are you two off toExercise 71-5 bbbabOutside viewExercise 3Uses of computers include: to provide travel updates, to operate trains, to analyze evidence, to control buildings, to switch on lights, to provide entertainment, to control the temperature and to close blinds.Places where computers are used include: homes, police stations, libraries and schools.Exercise 41 (a)2 (d)3 (c)4 (a)5 (d)Exercise 51 areas of life2 in our homes3 computer-controlled houses4 adjust the temperature5 give new instructions6 react to match7 TV and Internet8 outside changes9 stop too much sun from entering10 turn the oven onListening inExercise 21 Scientists at the University of Bristol carried out a two-month study to find the best way to dunk a biscuit.2 About one in four biscuits break up when dunked.3 Unlike biscuits, doughnuts are held together by protein gluten which doesn’t break down in hot liquids.4 Horizontally dunking a biscuit into tea allows a longer dunking time, as the liquid takes longer to soak into it.5 The hotter the tea the faster the biscuit breaks up.6 Dunking a biscuit in a hot drink releases up to ten times more flavour than eating the biscuit dry.Exercise 31 dunking biscuits2 held together3 absorb liquid4 travel through5 hold the biscuit6 producing a tableExercise 6The statements said by Peter are: 1, 2, 4, 6 and 8.The statements said by Louise are: 3, 5 and 7.Exercise 71 (b)2 (b)3 (d)4 (a)5 (c)6 (a)Unit 8Inside ViewExercise 21. Most weekends.2. Every day of the week. / All week.3. 10 am to 6 pm.4. It gets pretty lively as people go to the pubs and restaurants all around.5. They sell pretty well everything.6. It’s a famous club. / It’s one of THE great clubs in London.7. To the Electric Ballroom.8. No, she doesn’t.Exercise 3The statements said by Janet are: 4 and 8.The statements said by Andy are : 3, 6 and 7.The statements said by Joe are: 1, 2 and 5.Exercise 51 (c)2 (c)3 (d)4 (d)5 (c) 6(b)Exercise 6(1) to be having fun in London(2) wearing these amazing costumes(3) attracts about two million people(4) It takes place(5) the usual time(6) It’s a festival which takes place(7) for the rest of the year(8) It starts in half an hourExercise 71 (a)2 (a)3 (b)4 (b)5 (b)Outside ViewExercise 21. The lunar calendar.2. Red means happiness.3. Flower arrangements which include pine branches, bamboo and blossoms.4. Oranges and tangerines mean happiness, coconuts represent togetherness and lychee nuts represent strong family ties.5. Noodles represent long life.Exercise 31. so the exact date2. lasts for 15 days3. to send out the old year4. for the coming year5. red envelopes of money6. cleaning the house completely7. flowers will turn into fruit8. A whole fish9. during this holidayExercise 41. they’re very generous2. South Korea3. a family setting4. get your own plate; dig in together5. Asian; Americans6. American kids7. what customs they like8. KoreaExercise 51 (c)2 (c)3 (a)4 (c)5 (c)6 (d)Listening InExercise 2The true statements are: 2, 5 and 6.Exercise 31. making a guy2. burn him3. start of the 17th century4. beneath Parliament5. he was trying to light6. which they did7. no reason8. started buildingExercise 71.Because it’s a religious festiv al but she is not a religious person and so it doesn’t have that kind of meaning to her.2. It’s a good reason for families to get together, eat a lot of good food and give each other presents.3. Because it’s exciting to think that Father Christmas wil l come down the chimney and leave them presents.4. It’s a time to give thanks for everything you have.5. He says it’s probably as commercialized as Christmas.6. The shortest day of the year.Unit 9Inside viewConversation 11. Example answers1. The three friends are standing by the bar in a pub, probably discussing what to order. The barman is possibly filling a glass or standing ready for their decision.2. Probably not. She may in fact be asking for advice as the situation is an unfamiliar one.3. I am a bit puzzled---- bars usually have more exciting names. The Duke of York sounds odd, but perhaps it is a very old pub.4. It could be something to do with history or perhaps such names are memorable and are good for business.2 AnswersThe true statements are: 2and 5.3. Answers1(b) 2(c) 3(d) 4(c) 5(d)4. Example answers1. They look attractive and are memorable, and also they come from a time when fewer people could read easily.2. They could get their names from the people the first owners liked or wanted to please, features of the building, or they could be references to the location.3. They illustrate the name.5. Answers5-places 2-animals1-royalty or landowners 7-myths and legends4- objects 6- jobs3-symbols taken from the Bible6. Answers(1) where was I (what was I saying before)(2) You sound as if you know something about(3) where did I leave off (finish speaking)(4) OK, got you(5) and let me see(let me think)(6) My mind’s g one blank (I cannot recall for a moment)(7) if you’ll excuse me(8) It was great talking to you7. Answers1(b) 2(a) 3(a) 4(a) 5(b) 6(b)Outside view1 Example answers1. It’s the British Royal Family. There’s the Queen and her husband. And look, aren’t these William and Harry? The main Royal Family starts fourth from the left with Prince William and his younger brother, Prince Harry. Slightly to the back, behind her mother, stands Princess Anne, the Princess Royal. The Queen stands next, waving. The lady in white is the countess of Wessex, with just in front of her, her husband, Prince Edward. He is looking over the shoulder of her father, Prince Philip, the Duke of Edinburgh. The tall gentleman in uniform is the Princess Royal’s husband, Rear Admiral Laurence. The Duchess of Cornwall in blue stands next to her husband, Prince Charles, Prince pf Wales.2. They are royal.3. Your Majesty, I think for the Queen, for the first exchange and after that Ma’am. For princes Your Highness and after that, sir.4. Well, they are normal human beings but they live in palaces.5. The jewels would be nice but all the ceremony must be dull and the lack of privacy cannot be nice as princess Diana knew so well.2. AnswersPhoto 1: ElizabethPhoto 2: JamesPhoto 3: GeorgePhoto 4: Victoria3. Answers1. It’s used to refer to princes and princesses.2. It’s used to refer to the Queen.3. The German sounding name used by the Royal Family before.4. Te Royal Family’s popular family castle.5. The Royal Family’s sur name after 1960.6. At the wedding, Charles was recorded in the marriage register as His Royal Highness Prince Charles Philip Arthur George, The Prince of Wales.7. Popular names for royals.4. Answers1(b) 2(b) 3(d) 4(a) 5(b) 6(c)Listening in2. answers2-6-5-3-1-43. Answers4. Answers1. attractive, powerful: attractive, powerful2. to think of3. much too long4. meaning very small5. the best or the strongest6. most romantic lovers7. sound luxurious6. Example answers1. It seems to be about how names sound in different languages and changing your name when you get married.2. Clare is a gir l’s name and men do not change their name on marriage so it’sa woman speaking.3. Greek.7. AnswersThe true statements are: 3, 4and 6.8. Answers1.(c)2. (b)3. (c)4. (a)5. (d)Unit 10Inside view1. Walking2. She doesn’t know anything about London.3. Some existed; some did not.4. To have come to London with his cat to seek his fortune.5. He was Lord Mayor of London four times.6. We have no proof that he had a cat.7. The ghosts of London.4. Example answers1. They all look very pleased so they must be praising her.2. I think all the interesting places they have seen must have been pleased her.3. Perhaps working with Andy.4. Yes, I think they have a special relationship.5. Answers1(b) 2(a) 3(b) 4(d) 5(c)6. Answers1. Way to go2. That’s the way to do it3. Let’s hear it4. Good for you5. Thank you so much for your help6. couldn’t have done it7. we certainly did8. It’s extraordinary9. So what’s next7. answers1(b) 2(a) 3(b) 4(b) 5(a)Outside view2. AnswersThe true statements are: 1,3and43. Answers1. in the present2. to trick people3. got sunscreen in his eyes4. eating bananas5. were descended from apes6. humans and animals4. Answers1. The Gravity reduction story and the Noah’s Ark sto ry.2. The Gravity reduction story.3. The Gravity reduction story was a hoax; the Noah’s Ark is true (because something has been spotted.)5. Answers1. is based on a famous hoax2. would pass in front of3. at that moment4. the world was destroyed by a flood5. It is believed to be6. announced on the radio7. snow on the top of8. may or may not be Noah’s Ark9. we want to believe themListening in2. Answers1(d) 2(a), (b),(c) 3(e), (f) 4(d) 5(c) 6(a) 7(e) 8(e)3. Answers1. the huge differences2. there was only darkness3. there was light4. a small island5. Mother Earth6. a bird7. the sun, and the earth8. creation myth at all6. AnswersCallers 1,3,4 and 5 believe in big cats.7. Answers1(b) 2(c) 3(d) 4(b) 5(d)。
新标准大学英语视听说教程3 Units 1-10答案
New Standard College English (Book 3)Unit 1Inside ViewConversation 1Exercise 11 Janet is a Chinese student in England.2 She studies at the University of Oxford.3 She is in London.4 Probably she is visiting her friends or doing a tour around London.5 I can see Tower Bridge and the Houses of Parliament.6 She is talking to her friends.Exercise 21 Janet is not going back home to China. (Because she wants to work in London during the long summer holiday and find out what it’s lik e to live in this busy and lively city.)2 It is in the middle of summer.3 Janet is going to work for London Time Off, a website about London.4 Joe is Janet’s boss.5 Janet doesn’t know what she is going to do.(Because it is her first day working there.)6 Joe and Andy do not agree that New York is the greatest city. (Andy thinks London is.)Exercise 3Exercise 41 Janet wants to find out what the busy and lively city of London is like.2 Today.3 Joe doesn’t agree with Andy. (But they argue in a joking way.)4 It is not as great a city as London.5 She thinks London is probably the greatest city in the world. Conversation 2Exercise 55-6-2-3-8-7-4-1Exercise 61 don’t mind my asking2 He drives me crazy3 What do you mean by4 It’s the last thing5 we check out new events6 the musicians or the actors7 Can I ask you something else8 we’ve got an interview to do9 supposed to be on his wayEveryday English1 (b)2 (b)3 (b)4 (a)5 (a)6 (b)Outside ViewExercise 24-5-1-3-2Exercise 31 (b)2 (c)3 (c)4 (a)5 (a)Exercise 51 Bjoern (b), (d), (f)2 Wolfgang (a), (e)3 Pascal (g)4 Yosma (c)Exercise 61 So that they can learn something about themselves2 It can lead to a higher self-consciousness.3 It can lead to happiness.4 A strengthening of the personality.5 “Who am I as a person? Am I really happy?”6 He thinks students can get indications of happiness from teachers.7 Happiness scientists.8 They don’t write definitions on the board.Listening inExercise 21 (c)2 (d)3 (a)4 (b)Exercise 31 tolerant; rounded2 close to; stand up3 beauty; generosity4 an opportunity; beyond the one5 behaved; selfish6 pretend; see through7 arrived in; had to help8 difficult time; a huge amount ofExercise 61 Joan is an academic counselor at Manchester University.2 She is talking to a presenter and callers for a radio program.3 It is important, because their choices of subject are likely to have an impact on their future careers.4 He wants to work in IT.5 Not at all. (In Britain each university has a different mixture of courses; some courses can only be found in a few universities.)Exercise 71 strengths; weaknesses; personality; like; subjects; organized; confident; outgoing; a team; working alone2 future careers; into a particular area of work; chosen field; related industries; leading3 vocational; graduates; high-flyers; career; practical; transferable; recruitmentUnit 2Inside ViewConversation 1Exercise 2The true statements are: 2, 3 and 5.1 Andy mentions the names of two bridges, not one.4 Andy saw it go up when he was a child.6 It is one of the cleanest city rivers today, although it was very polluted in the past.Exercise 31 In Southwark, which is part of London2 About 120 years old3 It used to be raised three or four times a day4 not so often5 In the late 1980s and 1990s6 In the 1960sExercise 41 She’s really impressed.2 Because they couldn’t go under London Bridge.3 Just on this side of London Bridge.4 He remembers that many buildings were damaged from the war.5 They used to take you to the hospital because the water was so polluted.6 It is one of the cleanest city rivers in the world.Conversation 2Exercise 61-(b) 2-(b) 3-(b) 4-(d) 5-(d) 6-(a)Exercise 71 The thing about2 It’s amazing3 Let me see4 Anyway where was I5 You were telling me about6 That’s fascinating7 Let me thinkEveryday English1-(b) 2-(a) 3-(b) 4-(b) 5-(b)Outside ViewExercise 24-3-6-1-5-2Exercise 31 where there is war2 go to school3 working in 157 countries4 has never known peace5 bringing medicine6 get an education7 40,000 kids8 girls were not allowed9 50 per cent10 the mystery about her for 12 yearsExercise 41 (d), (g)2 (e)3 (c)4 (f)5 (a)6 (b) Exercise 51 (d)2 (a)3 (b)4 (b)5 (a)Listening inExercise 21 her husband2 a church in the distance3 her favourite aunt (and uncle)4 a farm5 two (the speaker and her brother)6 about 147 20 yearsExercise 31 (c)2 (b)3 (a)4 (c)5 (d)6 (a) Exercise 63-5-1-4-6-2Exercise 7Exercise 81 Because he thought it would make him grown-up.2 Because he was lying on the floor screaming and screaming.3 Because she wanted to go home and she couldn’t get her coat on.4 Because they used to fight (but actually, they’re just having fun).5 Because she had short blond hair.6 Because she had had some good times.7 Because he wanted to get a job and earn money.Unit 3Inside ViewConversation 1Exercise 21. He used to work in a theatre.2. He moved the scenery between the acts in the play.3. She saw My Fair Lady.4. To find out where Andy and Janet are … or to check if they are going to be late.5. He’s a theatre critic.6. She has to check the sound level.Exercise 3Exercise 4True statements are 2, 3, 4 and 5.Conversation 2Exercise 61 (b)2 (c)3 (d)4 (c)5 (a)Exercise 71. has just been to see2 Can you tell me something about it3 Tell me more about4 It sounds very unusual5 So it’s family entertain ment6 did I do something wrong7 Did you remember to8 Hurry upExercise 81-6bbaaaaOutside ViewExercise 2The true statements are: 1, 5, 7, 9 and 10.Exercise 31 the most famous2 broke all the rules3 looking directly at4 a sense of movement5 indicated a real place6 what is she trying to say7 covered up one side of her face8 we’re the subject9 seemed happier10 the mystery about her11 line up between12 tell a storyExercise 4Exercise 51 Her portraits and books both tell stories.2 The character or performer of the images.3 She is trying to capture a deeper essence of a person.4 He uses a pinhole camera which requires a very long exposure.5 She needs to work on the reflections in the water and the face of the boy.6 He links them together with a string.7 She tries to capture something about the soul, or essence, of the person.8 It represents the process of decay.Listening inExercise 21 The highlight was seeing the show Nanta.2 It’s a live show: part thea tre, part dance, part music.3 The music is a mixture of traditional Korean music, percussion and drums.4 In 1997.5 Because it’s a non-verbal performance.6 It’s set in a kitchen.7 They use knives, dustbin lids and kitchen utensils.8 Nanta means “random drumming” in Korean.Exercise 3The true statements are: 2, 4 and 7.1 Nanta is a mixture of traditional Korean with a Western style performance.3 They are preparing food for a wedding reception.5 They give cooking lessons to the manager’s nephew, not to the manager.6 They are totally involved but they don’t throw food.8 They have already appearedat the Edinburgh Festival.Exercise 6Exercise 71 (a)2 (c)3 (d)4 (c)5 (b)Unit 4Inside viewExercise 21 They’re preparing to interview Janet’s friend.2 The interview is part of a background series to ethnicrestaurants.3 The London Video Games Festival in Trafalgar Square.4 It’s very popular. About 100,000 people attended last year.5 They put up a huge tent where people6 Because it’s very popular.Exercise 31-5 bdabbExercise 61 The rise of e-book readers.2 That you’ll never run out of things to read.3 He complains that someone is using a mobile phone and he is picking up the signal in the other studio.4 She feels that she keeps making a mess of things.5 A report on how technology is changing so fast.6 Because Joe started the recording before Andy had time to adjust the sound level.Exercise 71 They’re not really like2 But the trouble is3 the great thing about them is4 there is nothing quite like5 more text messages than6 it’s my fault7 Just ignore himOutside viewExercise 21-6 bcbcddExercise 31 wax and feathers2 got off the ground3 thrust, lift and control4 Thrust5 the tail6 provide lift, control and thrust, and be light enoughExercise 45-3-2-10-4-1-8-9-7-6Exercise 51 inventions2 develop and test3 helped them understand and study4 the shapes of different wings5 made the front steady6 controllable7 distance and duration8 1000 test flight9 flew the first powered airplaneListening inExercise 21 Work in office-based jobs.2 People are not exercising their bodies and they are putting on weight.3 It is caused by long periods spent sitting at the computer.4 They ensure staff are sitting correctly at their computers and take breaks.5 It is caused by several factors: lack of natural air and light, having a lot of electronic devices and air-conditioning.6 They are installing better lighting and ventilation,increasing the number of plants and encouragingemployees to take breaks.Exercise31 18 per cent2 over 40 per cent3 a/one fifth (20 per cent)4 over a million5 roughly 30 per centExercise 6The true statements are 2, 7 and 8Exercise 71 the amount of the world’s farmland that ismanaged intensively2 the proportion of flowering plants that need to be pollinated in order to bear fruit3 the number of commercially grown crops that need honey bees4 the number of bees released by farmers in California to pollinate almond trees5 the time for a species of wild mango to bear fruit6 the time for a cultivated species of mango to bear fruitUnit 5Inside ViewExercise 21. It is Cantonese food.2. Indian and Chinese restaurants.3. They want to know about life in Chinatown and a bit of background and history.4. There are very few who actually live there.5. It’s much smaller.6. There are only three or four streets.Exercise 31. (d)2. (g) 3 (f) 4 (a) 5 (b) 6 (c) 7 (e)Exercise 5□1So where do you call home?☐ When did your family move to London?□3And how did they make their living?☐ Did your grandparents work in Chinatown too?□2So how long has there been a Chinese communityin London?□4And why did Chinatown move over here?☐ Can most British-born Chinese speak Chinese?□5And does it still feel like a traditional Chinesecommunity?☐ How do you celebrate Chinese New Year in London?☐ Which is the best Chinese restaurant in Chinatown? Exercise 61 (d)2 (b)3 (c)4 (b)5 (a)Exercise 7(1) I guess this is home(2) how long has there been(3) When the Chinese first came to(4) they were also famous for(5) At the start of the 20th century(6) from all over London(7) And does it still feel like(8) along with the ChineseEveryday EnglishExercise 81 (b)2 (b)3 (a)4 (b)5 (b)Outside ViewExercise 21. It’s peaceful and quiet and just the place to relax.2. They fight.3. During the mating season.4. When they’re on a crowded street or bus.5. She’d be very angry and tell them to move.6. Maybe throw a little sand in their face and make them move.7. Move his towel next to them and start a conversation.8. People can get a lot more aggressive.9. She’s waiting until someone wants her parking space. Exercise 31 (b)2 (c)3 (c)4 (d)5 (a)Exercise 51. He pulls into the parking space that the producer left.2. Because he was waiting first.3. Anger management counselling.4. Because the radio is on.5. A hearing problem.6. He would beep the horn, roll down the window and shout very rude things at the person who took the space.7. She would yell out of the window and tell them to move.8. It is important for survival.Exercise 67-1-4-14-11-12-5-6-8-2-9-13-3-10Listening InExercise 2•synergy: performance of effective groups > sum of individuals.•1930s Elton Mayo discovered “Hawthorne effect”:* Being in a study improves productivity regardless of other factors.* Personal identity, self-esteem and social context in which group works improveperformance.•1960s Tuckman described stages of a group.* 1 Forming: Individuals get to know each other.* 2 Storming: Individuals share ideas and creative energy.* 3 Norming: Group identity forms.* 4 Performing: Group works together.Exercise 31 (c)2 (a)3 (e)4 (g)5 (f)6 (d)7 (h)8 (b)Exercise 61 (c)2 (b)3 (c)4 (c)5 (a)Exercise 71. Over 250 people died.2. 36 new homes were rebuilt.3. It is two square metres.4. 30 per cent of the cost of the building or rebuilding their home is needed.Unit 6Inside ViewExercise 21. She thinks it’s old.2. Wood.3. A thatched roof.4. A kind of dried grass.5. They stand.6. A report on the summer season at the Globe. (As schools have terms, theatres have seasons.)7. Stratford-upon-Avon.Exercise 32. 16663. There are some seats but most people stand.4. May.5. About 130 kilometers.Exercise 41 (d)2 (b)3 (c)4 (a)5 (c) Exercise 6The true statements are: 1, 3, 4, 5 and 9. Exercise 7(1) when was Shakespeare born(2) when did he die(3) when did he come to London(4) don’t know exactly(5) what happened to him later(6) I reckon there are about(7) What I think is(8) I suppose it’s because(9) I’m really stunned(10) I guessExercise 81 (b)2 (a)3 (a)4 (b)Outside ViewExercise 2The true statements are: 1, 2 and 5. Exercise 31 (b)2 (c)3 (a)4 (b)5 (d) Exercise 4(1) I don’t like cycling(2) do something good(3) sit on a couch(4) and with two legs(5) life on the road(6) throw the bike(7) It’s been different(8) performing marvellouslyListening InExercise 21. New York2. afternoon3. 1554. 30 to 45 seconds6. 577. 29Exercise 31. there were few injuries2. catch fire3. made a successful landing4. taking in water5. helped into the boats6. were taken to hospitals7. as a hero8. without any enginesExercise 6Paul1. zoo keeper2. Al Gore3. making people take climate change seriously4. GreenpeaceClare5. mum, part-time accountant6. Melinda Gates7. co-founding the Bill and Melinda Gates Foundation8. Save the ChildrenExercise 7The true statements are: 1, 5 and 7.Unit 7Inside viewExercise 25-3-2-6-1-4Exercise 31 (c)2 (d)3 (d)4 (a)5 (b)6 (b) Exercise 51 It’s got everything to do with science.2 She thinks it sounds fascinating.3 At the museum4 She tells him Andy and she are going to spendthe night together.5 Joe is surprised and confused.Exercise 61 Why is it so special2 I suppose this is3 have special exhibitions for kids4 The first thing you have to do5 we’re really gonna stay the night6 While you’re getti ng7 where are you two off toExercise 71-5 bbbabOutside viewExercise 3Uses of computers include: to provide travel updates, to operate trains, to analyze evidence, to control buildings, to switch on lights, to provide entertainment, to control the temperature and to close blinds.Places where computers are used include: homes, police stations, libraries and schools.Exercise 41 (a)2 (d)3 (c)4 (a)5 (d)Exercise 51 areas of life2 in our homes3 computer-controlled houses4 adjust the temperature5 give new instructions6 react to match7 TV and Internet8 outside changes9 stop too much sun from entering10 turn the oven onListening inExercise 21 Scientists at the University of Bristol carried out a two-month study to find the best way to dunka biscuit.2 About one in four biscuits break up when dunked.3 Unlike biscuits, doughnuts are held together by protein gluten which doesn’t break down in hot liquids.4 Horizontally dunking a biscuit into tea allows a longer dunking time, as the liquid takes longer to soak into it.5 The hotter the tea the faster the biscuit breaks up.6 Dunking a biscuit in a hot drink releases up to ten times more flavour than eating the biscuit dry. Exercise 31 dunking biscuits2 held together3 absorb liquid4 travel through5 hold the biscuit6 producing a tableExercise 6The statements said by Peter are: 1, 2, 4, 6 and 8.The statements said by Louise are: 3, 5 and 7.Exercise 71 (b)2 (b)3 (d)4 (a)5 (c)6 (a)Unit 8Inside ViewExercise 21. Most weekends.2. Every day of the week. / All week.3. 10 am to 6 pm.4. It gets pretty lively as people go to the pubs and restaurants all around.5. They sell pretty well everything.6. It’s a famous club. / It’s one of THE great clubs in London.7. To the Electric Ballroom.8. No, she doesn’t.Exercise 3The statements said by Janet are: 4 and 8.The statements said by Andy are : 3, 6 and 7.The statements said by Joe are: 1, 2 and 5.Exercise 51 (c)2 (c)3 (d)4 (d)5 (c) 6(b)Exercise 6(1) to be having fun in London(2) wearing these amazing costumes(3) attracts about two million people(4) It takes place(5) the usual time(6) It’s a festival which takes place(7) for the rest of the year(8) It starts in half an hourExercise 71 (a)2 (a)3 (b)4 (b)5 (b)Outside ViewExercise 21. The lunar calendar.2. Red means happiness.3. Flower arrangements which include pine branches, bamboo and blossoms.4. Oranges and tangerines mean happiness, coconuts represent togetherness and lychee nuts represent strong family ties.5. Noodles represent long life.Exercise 31. so the exact date2. lasts for 15 days3. to send out the old year4. for the coming year5. red envelopes of money6. cleaning the house completely7. flowers will turn into fruit8. A whole fish9. during this holidayExercise 41. they’re very generous2. South Korea3. a family setting4. get your own plate; dig in together5. Asian; Americans6. American kids7. what customs they like8. KoreaExercise 51 (c)2 (c)3 (a)4 (c)5 (c)6 (d)Listening InExercise 2The true statements are: 2, 5 and 6. Exercise 31. making a guy2. burn him3. start of the 17th century4. beneath Parliament5. he was trying to light6. which they did7. no reason8. started building1.Because it’s a religious festival but she is not a religious person and so it doesn’t have that kind of meaning to her.2. It’s a good reason for families to get together, eat a lot of good food and give each other presents.3. Because it’s exciting to think that Father Christmas will come down the chimney and leave them presents.4. It’s a time to give thanks for every thing you have.5. He says it’s probably as commercialized as Christmas.6. The shortest day of the year.Unit 9Inside viewConversation 11. Example answers1. The three friends are standing by the bar in a pub, probably discussing what to order. The barman is possibly filling a glass or standing ready for their decision.2. Probably not. She may in fact be asking for advice as the situation is an unfamiliar one.3. I am a bit puzzled---- bars usually have more exciting names. The Duke of York sounds odd, but perhaps it is a very old pub.4. It could be something to do with history or perhaps such names are memorable and are good for business.2 AnswersThe true statements are: 2and 5.3. Answers1(b) 2(c) 3(d) 4(c) 5(d)4. Example answers1. They look attractive and are memorable, and also they come from a time when fewer people could read easily.2. They could get their names from the people the first owners liked or wanted to please, features of the building, or they could be references to the location.3. They illustrate the name.5. Answers5-places 2-animals1-royalty or landowners 7-myths and legends4- objects 6- jobs3-symbols taken from the Bible6. Answers(1) where was I (what was I saying before)(2) You sound as if you know something about(3) where did I leave off (finish speaking)(4) OK, got you(5) and let me see(let me think)(6) My mind’s gone blank (I cannot recall for a moment)(7) if you’ll excuse me(8) It was great talking to you7. Answers1(b) 2(a) 3(a) 4(a) 5(b) 6(b)Outside view1 Example answers1. It’s the British Royal Family. There’s the Queen and her husband. And look, aren’t these William and Harry? The main Royal Family starts fourth from the left with Prince William and his younger brother, Prince Harry. Slightly to the back, behind her mother, stands Princess Anne, the Princess Royal. The Queen stands next, waving. The lady in white is the countess of Wessex, with just in front of her, her husband, Prince Edward. He is looking over the shoulder of her father, Prince Philip, the Duke of Edinburgh. The tall gentleman in uniform is the Princess Royal’s husband, Rear Admiral Laurence. The Duchess of Cornwall in blue stands next to her husband, Prince Charles, Prince pf Wales.2. They are royal.3. Your Majesty, I think for the Queen, for the first exchange and after that Ma’am. For princes Your Highness and after that, sir.4. Well, they are normal human beings but they live in palaces.5. The jewels would be nice but all the ceremony must be dull and the lack of privacy cannot be nice as princess Diana knew so well.2. AnswersPhoto 1: ElizabethPhoto 2: JamesPhoto 3: GeorgePhoto 4: Victoria3. Answers1. It’s used to refer to princes and princesses.2. It’s used to refer to the Queen.3. The German sounding name used by the Royal Family before.4. Te Royal Family’s popular family castle.5. The Royal Family’s surname after 1960.6. At the wedding, Charles was recorded in the marriage register as His Royal Highness Prince Charles Philip Arthur George, The Prince of Wales.7. Popular names for royals.4. Answers1(b) 2(b) 3(d) 4(a) 5(b) 6(c)Listening in2. answers2-6-5-3-1-43. Answers1. attractive, powerful: attractive, powerful2. to think of3. much too long4. meaning very small5. the best or the strongest6. most romantic lovers7. sound luxurious6. Example answers1. It seems to be about how names sound in different languages and changing your name when you get married.2. Clare is a girl’s name and men do not change their name on marriage so it’s a woman speaking.3. Greek.7. AnswersThe true statements are: 3, 4and 6.8. Answers1.(c)2. (b)3. (c)4. (a)5. (d)Unit 10Inside view3. Answers1. Walking2. She doesn’t know anything about London.3. Some existed; some did not.4. To have come to London with his cat to seek his fortune.5. He was Lord Mayor of London four times.6. We have no proof that he had a cat.7. The ghosts of London.4. Example answers1. They all look very pleased so they must be praising her.2. I think all the interesting places they have seen must have been pleased her.3. Perhaps working with Andy.4. Yes, I think they have a special relationship.5. Answers1(b) 2(a) 3(b) 4(d) 5(c)6. Answers1. Way to go2. That’s the way to do it3. Let’s hear it4. Good for you5. Thank you so much for your help6. couldn’t have done it7. we certainly did8. It’s extraordinary9. So what’s next7. answers1(b) 2(a) 3(b) 4(b) 5(a)Outside view2. AnswersThe true statements are: 1,3and43. Answers1. in the present2. to trick people3. got sunscreen in his eyes4. eating bananas5. were descended from apes6. humans and animals4. Answers1. The Gravity reduction story and the Noah’s Ark story.2. The Gravity reduction story.3. The Gravity reduction story was a hoax; the Noah’s Ark is true (because something has been spotted.)5. Answers1. is based on a famous hoax2. would pass in front of3. at that moment4. the world was destroyed by a flood5. It is believed to be6. announced on the radio7. snow on the top of8. may or may not be Noah’s Ark9. we want to believe themListening in2. Answers1(d) 2(a), (b),(c) 3(e), (f) 4(d) 5(c) 6(a) 7(e) 8(e) 3. Answers1. the huge differences2. there was only darkness3. there was light4. a small island5. Mother Earth6. a bird7. the sun, and the earth8. creation myth at all6. AnswersCallers 1,3,4 and 5 believe in big cats.7. Answers1(b) 2(c) 3(d) 4(b) 5(d)21。
全新版大学英语听说教程第三册听力原文及答案
Unit 1Part BText 1Dating with My Mother (Part One)After 22 years of marriage, I have discovered the secret to keep love alive in my relationship with my wife, Peggy. I started dating with another woman.It was Peggy's idea. One day she said to me, 'Life is too short, you need to spend time with the people you love. You probably won't believe me, but I know you love her and I think that if the two of you spend more time together, it will make us closer.'The 'other' woman my wife was encouraging me to date is my mother, a 72-year-old widow who has lived alone since my father died 20 years ago. Right after his death, I moved 2,500 miles away to California and started my own life and career. When I moved back near my hometown six years ago, I promised myself that I would spend more time with mom. But with the demands of my job and three kids, I never got around to seeing her much beyond family get-togethers and holidays.Mom was surprised and suspicious when I called and suggested the two of us go out to dinner and a movie.'What's wrong?' she asked.'I thought it would be nice to spend some time with you,' I said. 'Just the two of us.''I would like that a lot,' she said.When I pulled into her driveway, she was waiting by the door with her coat on. Her hair was curled, and she was smiling. 'I told my lady friends I was going out with my son, and they were all impressed. They can't wait to hear about our evening,' Mother said.Exercise 1: 1. c 2. a 3.bQuestions:1. What would make the speaker closer to his wife, Peggy?2. What do you know about the speaker's mother?3. Which of the following adjectives best describes Peggy?Exercise 2:1. She suggested that her husband spend more time with his mother. She said to her husband, "Life is too short, but you need to spend time with the people you love. You probably won't believe me, but I know you love her and I think that if the two of you spend more time together , it will make us closer."2. 1) ...she was waiting by the door with her coat on and she had her hair curled.2) She had told her lady friends about this.Text 2Dating with My Mother (Part Two)We didn't go anywhere fancy, just a neighborhood place where we could talk. Since her eyes now see only large shapes and shadows, I had to read the menu for both of us.'I used to be the reader when you were little,' she said.'Then it is time for you to relax and let me return the favor,' I said.We had a nice talk over dinner, just catching up on each other's lives. We talked for so long that we missed the movie.'I'll go out with you again,' my mother said as I dropped her off, 'but only if you let me buy dinner next time.'I agreed.'How was your date?' my wife asked when I got home that evening.'Nice...nicer than I thought it would be,' I said.Mom and I get out for dinner a couple of times a month. Sometimes we take in a movie, but mostly we talk. I tell her about my trails at work and brag about the kids and Peggy. Mom fills me in on family gossip and tells me about her past. Now I know what it was like for her to work in a factory during the Second World War. I know how she met my father there, and know how they went through the difficult times. I can't get enough of these stories. They are important to me, a part of my history. We also talk about the future. Because of health problems, my mother worries about the days ahead.Spending time with my mom has taught me the importance of slowing down. Peggy was right. Dating another woman has helped my marriage.Exercise 1: 1. c 2. d 3. dQuestions:1. What does the story mainly tell us?2. Which of the following is true?3. What can you learn from the story?Exercise 2: 1. F 2. T 3. F 4. T 5. FQuestions:1.It can be inferred that the speaker’s mother often took him out to dinner when he was small.2.The mother has poor eyesight now.3.On their first date the speaker took his mother out to dinner and a movie.4.The speaker’s parents worked in the same factory during the Second World War.5.The speaker and his mother now meet once every month.Part CConversation 1:W: You know, many American parents are now wondering why they can't keep their teenage children from drinking.M: I'm aware of that. To my mind, it's the permissive attitude of the parents that is to blame.Q: What can you learn from the man's response?Conversation 2:M: Don't you think it's good to give our children a monthly allowance?W: I think so. It can teach them the value of money. With a monthly allowance they can learn to budget their expenses wisely.Q: What are they talking about?Conversation 3:M: Mom, I've got a part-time job at a supermarket. Three hours a day weekdays and all day Saturday.W: Congratulations, Tom. But are you sure you can handle it? What about your homework and your piano lessons?Q: How does the mother feel about Tom's part-time job at the supermarket?Conversation 4:M: Hey, Mary. You look so upset. What happened?W: My father had an accident the other day. He is now in hospital and will have an operation tomorrow. You see, his heart is rather weak. I really don't know whether he can survive it.Q: What's the woman worried about?Conversation 5:W : Mother's Day is coming soon. Could you tell me what sons and daughters do in your country on that day?M: Well, they send their mothers flowers and cards to celebrate the occasion. Besides, it is a common practice for them to wear pink carnations on that day.Q: Which of the following is true of the customs of Mother's Day in the man's country?1. b2. c3. b4. d5. dPart DMy First JobMy parents ran a small restaurant. It was open twenty-four hours a day, seven days a week. My first job was shining shoes for customers when I was six years old. My duties increased as I grew older. By age ten I was clearing tables and washing plates. My father made it clear that I had to meet certain standards. I had to be on time, hard-working and polite to the customers. I was never paid for any work I did. One day I made the mistake of telling Dad I thought he should give me ten pounds a week. He said, "OK, then how about you paying me for the three meals a day when you eat here and for the times you bring your friends here for free drinks?" He figured I owed him about 40 pounds a week. This taught me quite a lot.Statements:1. The speaker had more than one responsibility at his parents' restaurant.2. The speaker's parents kept their business open around the clock.3. It can be inferred that the speaker's family lived in the United States.4. It seems that the speaker's father was very strict with him but quite kind to his friends.5. The father finally agreed to pay his child for his work but would deduct the cost of his meals.6. This story shows that the speaker has very unhappy memories of his childhood.Unit 2Part BText1What a Coincidence! (Part One)Andrew had always wanted to be a doctor. But the tuition for a medical school in 1984 was 15,000 dollars a year, which was more than his family could afford. To help him realize his dream, his father, Mr. Stewart, a real estate agent, began searching the house-for-sale ads in newspapers in order to find extra business. One advertisement that he noted down was for the sale of a house in a nearby town. Mr. Stewart called the owner, trying to persuade him to let him be his agent. Somehow he succeeded and the owner promised that he would come to him if he failed to get a good deal with his present agent. Then they made an appointment to meet and discuss the thing.As good things are never easy to acquire, the time for the appointment had to be changed almost ten times. On the day when they were supposed to meet at 3 o'clock in the afternoon, Mr. Stewart received another call from the owner. His heart sank as he feared there would be another change of time. And so it was. The owner told him that he couldn't make it at three but if he would come right then, they could talk it over. Mr. Stewart was overjoyed. Leaving everything aside, he immediately set out to drive to the house.As he approached the area, he had a strange feeling of having been there before. The streets, the trees, the neighborhood, all looked familiar to him. And when he finally reached the house, something clicked in his mind. It used to be the house of his father-in-law! The old man had died fifteen years ago but when he was alive, he had often visited him with his wife and children. He remembered that, like his son Andrew, his father-in-law had also wanted to study medicine and, failing to do so, had always hoped that one of his two daughters or his grandchildren could someday become a doctor.Exercise 1:1. b 2. a 3. d 4. cQuestions:1. Who are the two main characters in the story you have just heard?2. How did Mr. Stewart get to know the owner of the house?3. What problem did Mr. Stewart have?4. What is the coincidence in the story you have just heard?Exercise 2:1984 / son / medical school / tuition / afford it / realize / newspaper ads / extra business / advertisement / succeeded / agent / changed / phone call / put aside / doing / immediately / familiar / father-in-law's / visited / his father-in-law alive / coincidenceText2What a Coincidence! (Part Two)When he entered the house, Mr. Stewart was even more amazed to find that the house was decorated exactly as he had remembered it. He told the owner about this and the latter became intrigued too. However, they were in for even greater surprises. It so happened that in the middle of their discussion, a postman came to deliver a letter. And the letter was addressed to Mr. Stewart's father-in-law! Were it not for Mr. Stewart's presence there and then, the letter would be returned as no person of that name lived in the house any longer. As the postman demanded a signature on the receipt slip, Mr. Stewart signed for his long-deceased father-in-law. Mystified, the owner urged Mr. Stewart to open the letter and see what it contained. The letter was from a bank. When he opened it, two words immediately met his eye -- 'For education'. It was a bank statement of an amount his father-in-law had put in years ago for his grandchildren's education needs. With the interest it had earned over the years, the standing value of the amount came to a little over $15,000, just enough money to cover the tuition of Andrew's first year at a medical college!Another thing that is worth mentioning is about the postman. The original postman, who had worked in this neighborhood, called in sick that day. So the postman, who was new to the area, came to deliver mail in his place. Had it been the old postman, the letter would undoubtedly be returned to the sender as he knew full well that no person bearing that name lived in that house any longer.The miracle was a blessing for Andrew. With the money given to him by his grandfather he was able to study medicine. Now he is a doctor in Illinois.Exercise 1: 1. T 2. F 3. F 4. F 5. FStatements:1. Several coincidences happened in the story.2. The coincidences made it possible for the owner to sell his house at a good price.3. No one actually benefited from the coincidences.4. It can be inferred that Mr. Stewart did not have to seek extra work from then on.5. With the extra money Mr. Stewart had earned, Andrew's dream finally came true.Exercise 2:1. He was intrigued.2. A bank statement.3. his father-in-law had put an amount of money in the bank for his grandchildren's education.4. A little over $15,000.5. He could use the money to cover the tuition of his first year at a medical college.6. He is a doctor in Illinois.Part CDad Stops for Gas, Finds Lost SonNueng Garcia was the son of an American serviceman stationed in Thailand in 1969. But his father went back to the States when Nueng was only three months old. When he grew up Nueng immigrated to the United States and worked as a gas station clerk in Pueblo, Colorado. His dream was to find his father John Garcia. Year after year, he tried in vain to search for information about the whereabouts of his father.It was a fine day in Pueblo. There was not a cloud in the blue sky. But for him, it was just another day on the job. Suddenly he noticed the name of one customer who paid with a check. The man, who was in his fifties, had the same surname as his own. Nueng raised his head from the check and looked at the man. Could this be his father?"Are you John Garcia?" he asked."Yes," came the answer."Were you ever in the Air Force?""Yes.""Were you ever in Thailand?""What's that to do with you?" answered the man, who became suspicious by then."Were you or were you not?" Nueng persisted."Yes.""Did you ever have a son?"At this truth dawned on the man. They stared at each other and realized at the same moment that they were father and son who were separated 27 years ago and half a world away.John Garcia hadn't seen his son since 1969. He lost touch with Nueng's mother when she started seeing another man. He moved to Pueblo nine years ago. He said he never went to that gas station, wasn't even low on gas that day and hardly ever paid with a check.Exercise:1. F 2. T 3. F 4. F 5. T 6. T 7. F 8. TStatements:1. Nueng's parents divorced when he was only 3 months old.2. After moving to the U.S.A., Nueng worked at a gas station in Colorado.3. Nueng never gave up his efforts to find his father, but John Garcia had never looked for his son.4. One day while at work Nueng's eyes fell on the photo of a customer's driver's license, and the man in the photo looked like his father.5. John Garcia was once in the U.S. Air Force stationed in Thailand.6. John Garcia and his son didn't meet each other again until 1996.7. Nueng's father said he often went to that gas station but never paid with a check.8. It was by coincidence that John Garcia and his son were reunited after many years of separation.Part DUnexplained ParallelsOne of the best-known collections of parallels is between the careers of Abraham Lincoln and John F.Kennedy. Both were shot on a Friday, in the presence of their wives; both were succeeded by a Southerner named Johnson; both their killers were themselves killed before they could be brought to justice. Lincoln had a secretary called Kennedy; Kennedy a secretary called Lincoln. Lincoln was killed in the Ford Theater; Kennedy met his death while riding in a Lincoln convertible made by the Ford Motor Company -- and so on.Similar coincidences often occur between twins. A news story from Finland reported of two 70-year-old twin brothers dying two hours apart in separate accidents, with both being hit by trucks while crossing the same road on bicycles. According to the police, the second victim could not have known about his brother's death, as officers had only managed to identify the first victim minutes before the second accident.Connections are also found between identical twins who have been separated at birth. Dorothy Lowe and Bridget Harrison were separated in 1945, and did not meet until 1979, when they were flown over from Britain for an investigation by a psychologist at the University of Minnesota. They found that when they met they were both wearing seven rings on their hands, two bracelets on one wrist, a watch and a bracelet on the other. They married on the same day, had worn identical wedding dresses and carried the same flowers. Dorothy had named her son Richard Andrew and her daughter Catherine Louise; Bridget had named her son Andrew Richard and her daughter Karen Louise. In fact, she had wanted to call her Catherine. Both had a cat called Tiger. They also had a string of similar mannerisms when they were nervous.How can we explain the above similarities?Exercise:1)Shot, Friday, wives2)Succeeded, Johnson3)killers, brought, justice4)secretaries5)Ford theater, Lincoln6)Died, accidents7)trucks, same road8)met, 34, seven rings, wrist, watch9)Married, wedding dresses, same flowers10)similar, children11)cat, TigerStatements:1. Both Abraham Lincoln and John F. Kennedy were killed by a Southerner.2. John F. Kennedy's secretary was named after Abraham Lincoln.3. The news story told about the traffic accidents that killed two twin brothers.4. It can be inferred from the passage that more parallel phenomena are studied in the United States than in any other country.5. Coincidences occurring in three nations are described in the passage.6. Some psychologists' interest is the research on coincidences between twins.7. According to the speaker, coincidences occur much more often between twins than between people who are not related.8. The speaker does not mention his/her own opinion on whether these parallels can be explained.Unit 3Part BText 1A Marriage Agreement (Part One)(Tom and Linda have signed a marriage agreement. Both agree not to break the rules outlined in the agreement. John, a reporter, is talking to them about the agreement.)John: Tom, Linda, first I'd like to ask you why you decided to write this unusual agreement.Tom: We found that many problems are caused when a person has different expectations from his or her spouse. We wanted to talk about everything openly and honestly before we started living together.Linda: Also we both know how important it is to respect each other's pet peeves. Like, I can get very annoyed if others leave stuff -- clothing, papers, everything! -- lying around on the floor. It really bugged me, so we put that in the agreement.John: This is mentioned in Article 1: Cleaning Up, isn't it? It says, "Nothing will be left on the floor overnight. Everything must be cleaned up and put away before going to bed."Tom: Then I'll know clearly what Linda's expectations are.John: I see. What about Article 2: Sleeping? It says, "We will go to bed at 11 p.m. and get up at 6:30 a.m. except on weekends." I'm sure some people hearing this will think that this agreement isn't very romantic. Tom: Well, we disagree. We think it's very romantic. This agreement shows that we sat down and talked, and really tried to understand the other person. A lot of problems occur in a marriage when people don't talk about what they want.Linda: That's right. When we disagreed about something, we worked out a solution that was good for both of us. I would much rather have Tom really listen to me and understand my needs than give me a bunch of flowers or a box of candy.Exercise 1: 1. b 2. c 3.aQuestions:1. Which statement best summarizes the marriage agreement between Tom and Linda?2. According to Tom, what will give rise to problems in a marriage?3. What can be inferred about Linda from the conversation?Exercise 2:1. Because she wanted to understand each other's expectations so that potential problems could be avoided and they could live happily together.2. Cleaning up. Everything must be cleaned up and put away before going to bed.3. Sleeping. Time for bed: 11pm; time to get up: 6:30am except on weekends.Text 2A Marriage Agreement (Part Two)John: Linda, do you spend a lot of time checking to see if the other person is following the rules? Arguing? Linda: No, not at all.Tom: A lot of couples argue because they don't understand each other's expectations. I think we spend less time arguing than most couples because we both know what the other person expects.John: What happens if one of you breaks a rule?Tom: Well, that's in Article 13 of our agreement.John: Is it? Oh yes, Article 13: Breaking Rules. "If you break a rule, you must apologize and do something nice for the other person to make it up."Linda: Yeah, like last time Tom broke the rule of driving.John: What's the rule?Linda: The rule is we must ask for directions if we are driving and get lost for more than five minutes. John: What happened?Tom: We were driving to a friend's wedding, and we got lost. Linda wanted to stop at a gas station to ask for directions, but I thought I could figure it out.Linda: Then we drove forty miles in the wrong direction and ended up being late for the wedding.Tom: So I took her out to dinner. I knew what I should do to apologize.John: That's very important, I think, knowing how to apologize. By the way, do you plan to update your agreement at all? What if things change in your life and a rule doesn't work anymore?Linda: We've thought about that too. Article 14 states that we must review this agreement once a year and make necessary changes.John: Well, it was really nice talking to you both. Thank you very much for your time.Tom & Linda: Thank you.Exercise 1: 1. F 2.F 3.T 4.TStatements:1. Tom and Linda never argue because they both know what the other person expects.2. Once Tom broke Article 14 and apologized to Linda by taking her out to dinner.3. If some of the rules in the marriage agreement become outdated, changes will be made to update them.4. It seems that both Tom and Linda are satisfied with their marriage agreement.Exercise 2:1. One rule says that if they get lost for more than five minutes when they are driving, they must stop and ask for directions.2. Once Tom and Linda got lost when they were driving to a friend's wedding.3. Linda wanted to stop at a gas station to ask the way, but Tom thought he could figure it out.4. As a result, they were late for the wedding because they went in the wrong direction for forty miles.Part CA Perfect MatchAre you looking for a good relationship with someone special? What type of person is the best personfor you? Is it the person with the highest IQ? Is it the most beautiful or most handsome person? How about the richest person or the most ambitious? Is your ideal partner the most traditional or the most modern person? Is he or she the person most like you, or most unlike you?The answer, psychologists say, is none of the above. Why? Because they are all extremes. In a number of research studies, psychologists asked couples these questions. The answers were clear. Most people are happy with moderation -- with partners who are not the most or the best (or the least or the worst). People are more comfortable with partners who are not so special.The research showed several other important things. In a love relationship, two things can cause trouble. First, trouble happens when both people get angry quickly. This is not surprising. Second, trouble happens when people don't expect to change themselves in a relationship. Do you stay calm when you disagree with someone? Are you ready to change yourself? If you can tolerate disagreement and are willing to change, maybe you are ready for a serious relationship.Exercise:1. ...not so special/not extremes2. a. ...get angry quicklyb. ...change themselves...Statements: 1. F 2. T 3. T 4. F 5. T 6. T1. The passage implies that the perfect match for you is a person who is most unlike you.2. The author argues that the most beautiful or most handsome person may not be your perfect partner.3. Moderate person, that is, the partners who are not the most or the best can be your perfect match.4. The research showed that an extreme love relationship between the two can cause trouble.5. The passage states that the anger is one of the causes that lead to the breakup of a love relationship.6. The perfect match lies in the people's attitudes to tolerate disagreement and be willing to change in a relationship.Part DHusbands and Wives Don't See Things AlikeLet's face it -- husbands and wives just don't see things alike. Take TV remote controls, for example. I'm a channel-grazer. When I watch the news, I flip back and forth through four different networks."It drives me crazy when you do that," my wife complains. I don't understand why she has no interest in other channels. After all, she is a woman who wants to know everything going on in the neighborhood and among all the relatives. Just one button away might be an interesting program on How to Lose Fifty Pounds by Eating Chocolate Sundaes or How to Understand Weird Husbands. But, no, she won't change channels, not even if she dislikes the program she's watching."This talk show host makes me so angry!" she cried one evening."Then why don't you change the channel?" I asked."Because I can't stand people who are always changing channels."Differences. No right or wrong, just differences."The first law of civilization," said an old philosopher, "is to let people be different."I don't need to convert my wife to my ways, and she doesn't try to make me be like her. We simplytake turns monitoring the remote control.Exercise:1.He frequently changes channels.2.No. It makes her very angry.3.She sticks to one channel even if she doesn’t like it.4.They take turns monitoring the remote control.5.How everything is going on in the neighborhood and among all their relatives.6.No. Because, as one philosopher puts it, “The first law of civilization is to let people be different.”7.Statements:1. The major difference between the speaker and his wife is their TV viewing habits.2. According to the speaker, he is more interested in talk shows while his wife is more interested in news programs.3. The wife seems to be more weird than the husband is.4. The speaker and his wife usually take turns working the remote control when they watch television.5. It can be inferred that women are generally more tolerant than men of their spouse's differences.6. The speaker and his wife maintain peace not by changing each other but by tolerance.Unit 4Part BText 1Being a Police Officer Is a Stressful JobInterviewer: Welcome to our program, Sam.Sam: Thank you.Interviewer: Sam, how long have you been a police officer?Sam: I've been a police officer for thirty years.Interviewer: Thirty years. And you've had different types of assignments on the police force, I guess. Sam: Yeah, I've done everything from patrol to undercover work to detective work, and now I'm supervising investigations.Interviewer: Sam, I think most people would say that being a police officer is a very stressful job. Would you agree?Sam: Yes, it's definitely a stressful job. But it depends on your assignment.Interviewer: So, what's probably the most stressful assignment you can have?Sam: I'd say patrol is the most stressful assignment.Interviewer: That's interesting! In what way?Sam: Well, I guess the biggest part of the stress is the fear factor -- the fear of the unknown. Interviewer: What do you mean, Sam?Sam: Well, in patrol work, you don't know from moment to moment who you are talking to or what their reaction is going to be to justify your presence. Let's say, for example, a patrol officer stops someone for a。
视听说3完整版详细答案
视听说3完整版详细答案第一单元12/19 take a break why not some other time party available listen without talk to you about researching background work on hoping for break may be it By the way1A/5 she doesn’t work…… her sch…… she has…… she didnot…… she often1B/5 kind of it’s about right I did past three years paid of earned break the case in comparison to depends on a lot harder in general my roommate way too for myself a balance 2A/5 confident relaxed tense in a bad mood2B/5 1)How about 2)too 3)Why don’t 4)enough 5)Let’s 6)to walk3/5 1)am taking 2)work 3)have 4)am writing5/5 sorry I don’t I’m sorry That’d be ——第二单元3/19 money Goss They this on nick8/19 couldn’t has lost won’t-10/19 Tali Make HeNew story she can’t believe11/19 Nick too Talia doesn’t might not be12/19 get expert run broadcast competition In fact Speaking ought to give away Good thinking handle care audio expert fast on it You do hard to believe wake up smell the coffee crazy famous taking a bribe smart I hope get in the way work on 1A/5 alittle There thought would1B/5 heard about was caught they say what to think stuff you’d like to really convinced actually natural athlete in the season any opinion about disqualify for the sake of shame to in trouble with start rumors 2楼2A/5 连线arise对come up what对what that’s对that2B/5 trus croo bogus authentic3/5 Have have ever ought lately You’d better5/5 Idon’t wow They say Ap hey you You’re第三单元3/19 Nick career star8/19 More not the nike10/19 1\The audio 2\Don’t be 3\最长的 4\to go and talk11/19 hasn’t finish he it nay trick her12/19 Bad news audio expert check urgent be sure absolutely sure have an idea may remember confide in reporter researcher chance lose one more day only one more day won’t be sorry story get tell me everything deserve a break storycharming charm out of1A/5 They didn’t she didn’t she needed pop corn It’s a story1B/5 1)was thinking 2)That would be ok 3)this new mall 4)having a sale 5)kind of 6)a whole lot less 7)just really 8)endup using little 9)Well 10)little girl 11)the whale 12)sounded really good 13)a lot 14)a lot less 15)you know what 16) treat you to2A/5 1)figure it out 2)investigate 3) result 4)make sense 5)ruined2B/5 urg对very to put对risk Sem对one of charm对to persuade3A/5 Talia对is able to she tell对be able to Tony对is not able Talia对is able 3B/5 yours mine5/5 I have an well,Idon’t If you Do you What do it’s worth Let’s go第四单元2/1 9 the asked her :so: he rent her a little N ick8/19 diffcult amusing dis English gland10/19 They could Did He think all To win3楼11/19 doesn’t he can he wants angry12/19 isten your side of the story Nope all alike judgeme trust only goal helping win deal with mess chargesserious threw a game gambling debts gave access to stop from Did you or didn’t you throw the game get show viewers Take your pick innocent1A/5Those Recently Time doesn’t He works He looks really 1B/5 ran into my gosh doing fantastic the same old howexciting perfect for or something like thata boring job gets to telemarketing telephone company2A/5 allow plan jour a part2B/5 Take a pick /T ake it easy/Take your time /Take a look3A/5 aa the a3B/5 aren’t /will you/does she/could he/hasn’t he/doesn’t she/didn’t I/wasn’t he5/5 I think I know you How have you been No,I’m sorry I’m afraid you’ve got It was great Here’s my card 单元测试1/3How did对He no longer when对when2/3 Nick对Which story Nick对the same3/3 The announce ……plays The announce talks about poetry……identifics1/3 in a bad mood /exhausted2/3 trustworthy/dishonest3/3 disgraceful action relax not guilty be……sense of planto don’t hurry1/3 are am Let’s go too much Why don’t I4楼2/3 received am going to ever should ’d better3/3 aren’t you an was the have seen good my am ableto dfferent haven’t2/5 serious talk busy3/5 different same different5/5 rising risingSPEAKING1/3I’m sorry it sounds I just don’t that would be That sound really good 3/3If you Iwill spend That’s Ijust Let’s 第五单元3/19 It’s im He was Shy8/19 very she plays he anything she wants Nick to know unbelievable 10/19 He’s not He Nick He’s getting11/19 I’would Talia shocked annoyed12/19sure sounds like stupid a minute deliberately from college works for recognize teammate bothexcuse us media you’ve got that right get it worry you getting some pressure sit out badlyfrankly win without you1A/5 call Her she couldn’t 100 A little1B/5 the whole story on the phone this rebate A hundred dollars supposed to of the camera nice aboutit serial number is gone Oh man 8002A/5become excit succ…… like begin2B/5 1)do you feel 2)do you think 3)are loving 4)such 5)so 6)believe2009-11-21 10:125楼3/5 so /such a /so /such /so /such a5/5 1)can I ask you to take a2)I have to take care of3)I’m tied uo at the moment4)Would you mind if5)Can you please check6)OK,no problem7)please fill this form第六单元3/19 She was No the result Talia8/19 1\Nick put50000 into hisbank account 2\she believes 3\he owes 4\making money 5\people 6\Ibel that 7\can’t 9/16 keep investigating have no choice going with beat us to it You’ve got to admit missing something asthey seem in this case too trusting skeptical all right working on fair let my emotions color myjudgment let me down won’t be sorry10/19 speptical He believes should work The bank11/19 they have to some want Dony1A/5 are allow Wise stop ID Dany1B/5 says at bars to have their parents thirteen years old get drunk you know drinking irresponsiblytheir kids baby-sitter bar owners this is happening crazy2A/5 Take对we have we don’t 对we decide For对For one we never对we are 2B/5 1)deposited 2)bank account 3)As a matter of fact 4)Take it from me 5)For one thing 6)except for 7)go with 8)beat us to it 9)let us down6楼3A/5 going/talking/eating/yourselves/myself/had known/would have brought/crying over /enjoying3B/5 1)may 2)may not 3)Is he 4)will 5)might not 6)may 7)aregoing to 8)might5/5 Do you think might perhaps It’s didn’t Is it possible that Nick didn’t take the money might第七单元3/19He explained 最长的 annoyed8/19 It’s brand He agreed Because+最长的By cheatingg Because he wants to amuse Talia Because angry she was angry Nick had not told here the truth10/19 He wasn’t going to tell A business woman TO visit To wear11/19 He was curius He will wear it would She want to ……truth12/19 here it comes juice bar Aren’t you Do I know you Not yet interesting proposition Keep goingLet’s say deal endorse athletic That’s it business card on second thought pay visit1A/5 They party+最长的 Thefirst job in it she wanted shemight Thefirst could go to earlier1B/5 great opportunity audition for such a wonderful show the same night other plays coming along so perfect so great about be invited go for it2A/5 They paid me so that Ichanged I want to know The shoes will becone Ok It doesn’t come and experience 2B/5 confirmed lines cone out basically endorsed3A/5 1)was taking 2)called 3)checked 4)was playing 5)quicker 6)more concentrated3B/5 would rather prefer to would prefer to2009-11-21 10:127楼5/5 soundslike fun or really? oh,really? Isee How awful How did it go Did you have a good?第八单元3/19she was trying Talia there was8/19 he meant to make meet jack hci had never jackie has neverworked Talia might G ower Buil ding Frustra show forten years10/19 Because she thought Nick had lied to her Neither she was very she used the recoptionst’s11/19 he enjoy finding show her anger she thinks confsed 12/19 dead for a moment angry yell at Maybe Probably guest dial in big trouble have trouble with used to memory to makematters worse ridiculous took lunch voice mail available odd telling thetruth lying see a good story1A/5 she asked for Try to she could meeting 4321B/5 looking for I mean quite a while at the desk Whatever Kind of hard for her name impossible totally screwed up pretty clear meet me lobby 4 o’clock good idea try where she is why don’t you how that goes2A/5 please wait sorry+短的 If you+长的Nick ……punished Tia+长的 The right now2B/5 odd Anyway In that case yell at ridiculous3A/5 where I can When the how much it what kind of used to3B/5 someone / used to /didn’t use to /something /anything /单元测试2LISTENING1/3Talia tells Nick that she believes him: {1.Nick meets Jackie baker8楼 2.Nick explains the deal he made to Talia.3.Talia decided to do see Jackie.2/3 1.The receptionist gives the office location.2.The receptionist gives the directions to the office.3.The receptionist asks for a signature3/3He had a health accepting He accepesVOCABULARY1/4get along get going2/4criticizing pressure3/4mutter feelforsomeone. fellfunn whisper4/4 skeptical asking tostep acknowledged down madeup approachable Let them off transfGRAMMER*/2 (Amy:Hi,Ronnie) 22111即 better were having more intelligent was listening would rather*/2 (Dear Mom) 12122即used to be somebody who that person is anybody where she lives PRONUNCIATION1/4cann’t can used2/4he /E/ her4/4 she up at 长的1/4 sorry to how was it?3/4 I really double it It’spossdidn’t I’m tired up oh,really? Ihave to take care of Did he have4/4 oh,really? How was That’s great第九单元3/19 5点 looking for There8/19 Because he needed the recept he was still Because hewondeved He wasn’t very He over To find 6点9楼10/19 Because he was trying Tell the she has blue he just 11/19 I’m confused help she never12/19 anything else someone else either In fact cheer up as bad as describe business suit excutive at all1A/5 she can bring cook for Go to Aby’s Emily’s1B/5 favor wondering bring two of my friends definitely supposed to messed up have a great time decorations last minutecooking things great to serve 6:30 three of you2A/5 the news+短的 Are you interest Hey, can may you +长的 I hend by she +短的2B/5business overheard follow describ cheer up3A/5 1)rushed 2)was checking 3)was playing went3B/5may as honest as as positive as can could as disgusting as5/5 sorry,but No,pr…… sure can I leave ma y be I can is it ok Do you第十单元3/1 9 The woman The inter……did not answer An……Dear8/19 he got into he made an he could not Things wer badly hewanted the woman the soccer the intertiew10/19 Dean’s They wear both she felt sorry she took10楼11/19 he wespec ts she has sarc…… sorry12/19around lately ran into admired ruining his career prettysure different changing the color wannabe tried outExcept for took lunch performance beginning to unfoldOn the house in his favor soccer professionally1A/5 do a survey noise is a the univer+长的 housing therre should1B/5 on behalf of a couple of minutes greatly appreciated more time building classrooms dorm roomsobviously point better quality more people at least pretty nice spacious rental houses stay in mixedfeelings involved in helps them out definitely issue2A/5will be get up stop to his unexp be made2B/5 uspended preformance catch up on on the house trying out3A/5 on with/out /up3B/5 losing /saying/ to need/ to wait3C/5 until/when/have5/5 Actually T o tell you what do you I’m not really 同上 If you ask Frankly第十一单元3/19 she think To tell How good8/19 he understand she joked……reporter upset she knowNick Nick she talks……party10/19 It’s nicer he’s going……happened no kick+长的11楼11/19she is angry she doesn’t Dean sorry,Nick12/19 won’t be sorry admit lied There you are are got reservations just around the corner doing business so much pleasant talkoverover lunch sign basically says endorse the shoes tricked out of the way next in line star player amazing team office make sure1A/5 Sunday write Next w…… 4:30 M……1B/5 are responsible for Africa visual aid in the outline easy look that up really quick have it all done due Wednesday needto meet I’m supposed to do compile get our project done off the Internet helpful use bring those in tomorrow2A/5They+短的 jose+短的 jack+长的 we+短的jane’s+短的2B/5 persuasive tricked persuade raise broke over out of this word3/5 went to see In orderto don’t have to help can’t to talk 5/5 I’ve got to is there anything Nothing I really need to Do you That’ll be第12单元3/19 To keep By working Nicknever had8/19 Nick is more To tell him he is That having money problem they have been hard to the so长的10/19 Surprisees长的He want’s ......truth To prove He didn’t (i)2009-11-21 10:1212楼11/19he is N ick’s tell Nick 长的 almost uncertain12/19buddy Tough rap really happened scheme talented plotting for dreamed up fake planning impressedtalking crazy expect figure out made up craziest stories pulledoff typical so sure of popular prove———-1A/5 she could she turned长的 A map of Africa Tuesday3小时 Teacher1B/5 the habitat of the animalsblue folder rest of the projectmap definitely different spotturned it in reliable sourcecoming to me instead of positively check with2/5 handed it in figured let you turn it3A/5 how long for since has been playing3B/5 figure them out help you out put them away clean it up the most expensive the best5/5 I’m not quite sure what you’re getting at. /Exactly./Do you mean that/NO,that’s not what I mean./ Could you go over it again? / Are you saying that测试LISTENING1/4 howdoes对He listened he wants to2/4 says he hasn’t heard of Kicks shoesto help Nickeye color3/4 Spread on the mustard:1.Put on the cheese and avocado.13楼 2. Put on the tomato and cucumber3.Add the secret ingredient.4/4 Gomez对if her team The team appearingVOCABULARY—————1/4 Marcello:Hi,Amy: pulled it off pass on2/4 Talia:Hi,Mom: Keep cool play it by ear3/4 come up with break down4/4 out of control out of this worldGRAMMER—————1/4 the luckiest pick him up best for dream this up2/4 Tony:So,Talia: think of working could start was doing as difficult as 3/4 Secretary: may to talk as easy as will give 4/4 interesting to buy surprised to invite havePRONUNCIATION1/5 up out2/5 I want to get and it3/5 single sound spr…… gl……4/5suprised going5/5 I have to has is —————SPEAKING1/3 Yes,what do you neeed I really need to2/3 Are you saping it Yes, that’s whatI mean3/3 Are you saying it didn’t go well Yes,that’s what Imean 过级最终测试Level Test—————listening1/5talia thinks…eliminated—the soccer teamthere is a rumor—has an injurytony thinks nick—a good soccer2/5what does the coach say the socer—they want nick not to palywhat does the coach ask to be—he doesn`t trustwhat dose nick say the tv station—he planned ahead3/5nick says his life is—a messnick says he needs—the newsdean doesn`t want to—comment about nicknick agreed to endorse—shoes4/5OK, I’m wondering…:couple sit-down silverware accommodateeasy-going understanding favor attractive settingsshe knows it’s kind of out of your way for us to go to this party Pick(注意大写) up anything else get somesome wine or dessert or bring anything5/5Alex.My old boyfriend Alex.:I looked really good toolook your bestNo way doing things and moving onhang out or somethingvocabulary1/6talia:i`mtry,but—truthamy:what`swrong,talia?—exhautedamy:you need to rest more—easy2/6which phrase means to want to do something?—feel like doing someting Which phrase means to understand something?—get itwhich word describes a loud way of speaking?—roar3/6dean:well i can tell you—reactionshoutthrough it4/6patty:he`s innocent—out of the waytalia:i know—dream uppatty:i can`t believe—wait and see5/6two boys were caught smoking—let them offexcuse us for a minute—asking to step asidethe government is tring to—downwe…for lost time by—made up6/6figure out—be able to come up withtake your time—don`t hurrythrow a game—plan to lose a sports gamegrammar1/4Tony:I(选词) : want am having would rather anyone better nick:i don`t know what to do—through itdean:i can`t believe all of—shout2/4dean:itink nick should—couldcoach:at first—was hoping3/4patty:well,i could add—hold on secondnick:thanks,i appreciate—best4/4talia:i…to see nick—havedean:why do you need to see him?—to talkdean:i think he`s too busy—concernedpronunciation1/6falling rising falling2/6forget debts talk3/6men{tion} ab{so}lutely4/6He…stuty—used to can’t5/6(br)eak (str)eet6/6looked—single sound talented—extra syllablespeaking1/2mark:what do you think about—frankly2/2but i`ve got one favor to ask you—ok.no problemhe was accused of taking drugs—yeah.absolutelyyou won`t believe who i ran into today—whoif you go shopping with me—that sounds goodyou studied so hard on the test—no.i didn`t prepare for it at all。
新编大学英语视听说3Unit1听力原文和答案备课讲稿
Unit 1Part OneListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian.Interviewer: That sounds complicated. Could you explain what you mean?Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to what is polite?Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person?Angela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you suffer and cry for people you don't know, or over a movie that’s only a story, then I think that's a little too sensitive. That's the way I am.I am also a very independent person. I must do things by myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like; and I would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell others any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BListening IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody andself-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different.Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. self-centered5. blond medium height6. runner-upExercise 21. T2. F3. T4. F5. FListening IVDavid: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susan5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter A G IFurther ListeningListening IOne day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) swearing 8) perfectly 9) wildly 10) beeListening IITom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. Taylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything.Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7. D8. C1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. Miller D patient3. Mr. Smith E honest4. Jake A stubborn5. Mrs. Duke F creativeExercise 21. favorite way to relax2. how to divide3. bad unripe4. stiff sore5. fastening a basketball hoopA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scot s’English 2) the friendliest people 3) much nicer than 4) English courtesy 5) no views on the matter/no comments on the matter。
视听说III 原文和答案 Unit1
VLS B3 Unit 1II. Basic Listening Practice1.ScriptW: Have you chosen your elective for next semester yet? Are you taking French writing again?M: Yes I am, but it’s compulsory for us next semester. So I think I’m gong to do marketing as an elective instead.Q: Which class will the man choose as his elective?2.ScriptM: Did you go to that businesses lecture on Friday? I missed it and need to copy your notes.W: I’d say you could borrow my notes, but Sarah’s got them. Be careful not to miss Professor Brown’s seminar; he takes attendance in that.Q: What is the woman telling the man?3. ScriptW: Wow, Steven! In the library! What brings you here?M: I’m enjoying the view. All the girls in fashion design are here are preparing for an exam on Monday. Q: Why is the man in the library?4. ScriptW: How’s your group doing with this statistics presentation? Mine’s terrible.M: Yeah, mine too. David and Mike are OK, but Steven doesn’t pull his weight and Suzie’s never around.I don’t see how we can pass unless Steven and Suzie realize that this is their last chance.Q: What is the true of Steven and Suzie?5. ScriptW: You took an MBA at Harvard Business School, didn’t you? What’s it like?M: It’s expensive, about U.S. $ 40,000 a year, plus the costs of food and housing. But the teaching is first class. The professors have a lot of practical experience. They use the case system of teaching; that is, you study how actual businesses grew or failed.Q: Why is he MBA teaching in Harvard Business School first class, according to the conversation? Keys: 1.C 2.D 3.B 4.D 5.AIII. Listening InTask1: On the First DayScript(V oice-over: Harison meets Jenny before the first class.)Harrison: I'm Harrison. Good to meet you.Jenny: Good to meet you. I'm Jenny.Harrison: So, you've bought the books for this biology class.Jenny: Yeah. I think everyone had to before class started. 'Harrison: No. Usually no one does much on the first day because it's still add-drop.Jenny: What's that?Harrison: Changing from class to class to find out which is best.Jenny: Have you had this teacher before? I've heard he is really good.Harrison: He's good if you're a hard worker. He expects a lot.Jenny: Oh, I guess that's good. I hope I can keep up with everyone else in the class. Maybe I need your help after class.Harrison: You're welcome.(V oice-over: Jenny catches up with Harison after the first class.)Jenny: Harrison, wait up!Harrison: So what do you think of the professor's lecture?Jenny: I think about half of what he said went over my head.Harrison: Don't worry. A lot of what he said is explained in the reading.Jenny: Hey, would you mind if I borrowed your notes tonight to look them over?Harrison: No problem. We don't have class until Wednesday. Here you go.Jenny: Thanks. I just want to make sure I'm prepared for the seminar.Harrison: Yeah. Participation in the discussion is an important part of the education here.Key(1)the first day (2)changing (3) really good (4) hard workers (5) went over her head(6) explained (7)notes (8)Wednesday (9) participation (10) educationTask 2: How to select elective courses?ScriptConsider these tips on elective courses and you'll choose those that will serve you best.To begin with, you should select the courses that fit your profession. It is a good idea to choose elective courses closely related to your chosen profession. Potential employers will appreciate every bit of extra training and knowledge that they don't have to give you. For example, you may select elective courses in chemistry, biology or even physics if you are doing a science major. For business majors, select electives in accounting, business administration, and even computing, as you'll never know when these will come in handy in the corporate world.Moreover, you can choose an education that includes many fields of study. If you are taking a heavy load of career-related courses, you may prefer electives that are not directly related to your major. If you receive a well-rounded education, some employers believe that you have better potential. For example, if you have courses in science along with your business degree, you could possibly win a job over someone who majored purely in business with no outside electives.Finally, you can also select a challenging elective course. Part of getting an education is learning how to learn, and elective courses should help you achieve this goal. You need not to memorize all the information from each class, but you should get a better understanding of the world. So, pick elective courses that challenge your belief system and make you look at the world in a different way. For instance, you can consider a philosophy elective if you have been told that you are a little narrow-minded.Key(1) extra training (2) chemistry(3) accounting (4) many fields of study(5) better potential (6) business degree(7) challenging (8) how to learn(9) better understanding (10) narrow-mindedTask3: How to Get Straight A’sScriptIt is interesting to note how straight A students achieve academic excellence. Here, according to education experts and students themselves are the secrets of super-achievers.First, they know how to set priorities. Top students allow no intrusions on study time. Once the books are open or the computer is turned on, phone calls go unanswered, TV shows unwatched, snacks ignored. Study is business, and business comes before recreation.Also, good students can study anywhere and everywhere. Claudia Hill, an Arizona State University business professor recalls a cross-country runner who worked out every day. Hill persuaded him to use his spare time to memorize biology term. Then he posted a list of biology terms on the mirror in the bathroom. He learned a few terms every day while brushing his teeth. Eventually, he scored high on the final examination.Moreover, top students schedule their time well. Study times are strictly a matter of personal preference. Some work late at night when the house is quiet. Others awake early. Still others study as soon as they come home from school when the work is fresh in their minds. All agreed, however, on the need for consistency. A student says, “Whatever I was doing, I maintained a certain period of time every day for studying.”Another important characteristic of super-achievers is that they know hoe to read, According to a book entitled Getting Straight A’s, the secret of good reading is to be “an active reader-one who continually asks questions that lead to a full understanding of the author’s message”.1.Which of the following is NOT mentioned about super—achievers starting to study?2.What did the runner do to score high on the exam?3.What is the good thing all top students agree on?4.What does the speaker mean by “an active reader”?5.What is the main idea of the passage?Key: 1B 2.C3. D 4.A 5.DIV. Speaking OutMODEL 1 Y ou’re just going to have study hardNora: Only our first day back at school, and already I feel like I’ve learned a lot.Chris: Only our first day back at school, and I already feel like I’m up to my ears in homework.Nora: You’re going to have to hit the books if you want to keep your grades up.Chris: Tell me about it! I already have two reports, two books reports, a composition, an oral report, anda research project—all due before midterms.Nora: We could work together. Maybe some of my organized study habit would rub off on you.Chris: Better yet, maybe you could do my homework for me.Nora: Forget it! That would be cheating.Chris: All right, all right. I have yet to write a term paper. Can you recommend any articles and books?You’d better find me the exact pages where I can find what I want.Nora: You could borrow ideas from references, but if you quote without giving the sources, you’re plagiarizing.Chris: The quiz next week will be a headache. If you don’t help me, I’ll have to prepare some study sheets and hide them in my hand when I take the test.Nora: Oh, no! If you’re caught, the professor will definitely give you an F. Probably, you will have to repeat the year.Chris: All right, I’ll take your advice. The library is going to be my new home, and in the dorm I’ll be burning the midnight oil.MODEL2 Which class do you prefer?ScriptChris: First period is math with Mr. Woods. I don’t know how am I going to stay awake?Nora: I like Mr. Wood. He’s interesting.Chris: He’s boring! He could put the entire basketball team to sleep—during the championship game!Who do you have for economics?Nora: Mrs. Jenkins. She’s smart. Students really learn a lot from her.Chris: She’s tough! You have to work hard in her class, or you’ll probably fail.Nora:No pain, no gain.Chris: Nonsense, You could have learned even more with Mr. Sharp. But not many students opt for his class.Nora: What’s wrong with him?Chris: Often, the highest grade he gives on a term paper is C+, and he usually fails half of the students. Nora:No wonder he’s got the nickname Mr. Shark. Well, how about PE? What are you doing this semester?Chris: That’s the worst part. In PE, we’re learning t’ai chi. I’m bored to death.Nora: Ha-ha! Not to rub salt into the wound, but our class is playing your favorite sport: basketball. Chris: Oh…that figures! This is going to be a terrible semester.Nora: This is going to be a great semester!MODEL3 Publish or perishScriptChris: Tell us, Professor Grant, What are your primary duties as a professor?Professor Grant: Well,I do a lot of research and writing.It’s rough being an associate professor. It’s publish or perish.Chris: So you spent a lot of time in your office?Professor Grant: Yes, but I also have to prepare class motes, give lectures, hold office hours. Teaching is an important part of being a professor.Chris: With all those responsibilities, you must make a lot of money.Professor Grant: I wish. Actually, I spend a lot of tome applying foe grants to fund my research. Then Ican offer assistantships and scholarships to the worthy graduate.Chris: I see why they call you “the boss”. But being a professor sounds pretty competitive. Professor Grant: Actually, I think you were in one of my classes…Chris: Um….I think you’re mistaken, Professor Grant!Professor Grant: No, I remember very clearly now! You owe me an essay!Chris: Sorry, I have too much work to do for the Student Union Newsletter, and I have to work two jobs to pay for school.Professor Grant:So you get an F in this course.V. Let’s TalkInterviewee: It's a really difficult balance to strike, actually maintaining the (1)quality but making sure as many (2)young people as possible and older people as well-there's been a surge in the number of over 25s applying, and wetake many people who are over (3)25. But we've got to get that balance right. It's going to be terribly(4)difficult for us next year.Hostess: Given the cuts that the (5)government announced a couple of weeks ago, and the numbers that we know in terms of applications, where are you going to draw that line? Are you going to have to look at cuttingintake in order to maintain the (6)quality of the courses?Intewiewee: We're trying not to (7)cut intake at the moment. But what it means is we're going to have to be(8)extra-cautious in the number of offers we make, because we simply cannot (9) afford to go over ourquota of the number of places that we can offer. Because if we do, it means that we could be fined, or wejust simply haven't got enough money to make sure the students' (10)experience is right. So it means thatmaybe last year we would allow a few (11) more people to have an offer. This year is going to be tougher. Hostess: Do you lay some of the (12)blame for the situation at the door of the government?Interviewee: If you look to France, Sarkozy is actually increasing the (13)budget for higher education.Obama in the U.S. has done the same thing. So we're just slightly (14)puzzled as to why the governmentseems to- be cutting back on higher education rather than pumping more money into what we think is a(15)service that is absolutely vital for the economy.VI. Further Listening and SpeakingTask1:ScriptHi, everybody. My topic today is “Problems with Our Educational System”.There are a lot of things in our educational system that I don’t agree with. It seems that educators just want to give standardized tests, which focus only on academic performance but neglect students’ abilities and interests in other areas. I think there’re a lot of people who are very intelligent, but haven’t had the opportunities they could’ve had, had they been educated in a broader-minded educational systems. I feel that a lot of courses that students are focused to take in high school are too academic, and, as a result, many kids lost their interest in learning.Educators have failed to recognize various kinds of intelligence. They often exert a lot of pressure on students to be as well-rounded as possible. I think being well-rounded isn’t really possible. And as a consequence some students who are believed to be intelligent can’t get into good colleges if they, for example, haven’t scored well on the math section, even if they ate brilliant writers.Another thing that disturbs me is that the so-called “weak students”are separated from the rest of theschool. Some kids are kept in a separate class id their grades are lower then others. And they’ve very aware of their social position, you know. I think it causes them to act in a way that is not really positive. They’re just acting in a way that they are expected to act. Often their grades go from bad to worse. And that’s pretty sad to me. I think that many of the kids in those classed are intelligent, but never actually realize their potential because of the way they are treated very early on in their education.Key(1) standardized tests (2) abilities and interest (3) interest (4) pressure(5)well-rounded (6) get into good colleges (7) the rest of the school (8) from bad to worse Task 2: The Final ExamScriptAt a university, there were four sophomores taking a chemistry course. They were doing so well on all the quizzes, midterms, labs, that each had “A” so far for the semester.These four friends were so confident that on the weekend before finals, they decided to go up to the University of Virginia and party with some friends there. They had a great time, but after all the hearty partying, they slept all day Sunday and didn’t make it back to school until early Monday morning. Rather than taking the final then, they decided to find their professor after the final exam and explain to him why they missed it. They explained that they had planned to come back in time for the final exam, but, unfortunately, they had a flat tire on the way back, didn’t have a spare, and couldn’t get help for a long time. As a result, they missed the final.The professor thought it over and then agreed they could make up the final the following day. The guys were relieved and elated. The next day, the professor placed them in separate room, hand each of them a test booklet, and told them to begin.They took at the first problem, worth five points. It was a simple question on a chemical reaction. “Cool,”they thought at the same time, each one in his separate room, “This is going to be easy.” Each finished the problem and then turned the page.On the second page was a question worth 95 points: “Which of the tires was flat?”Task 3 Harvard UniversityScriptHarvard University is the oldest institute of highest learning in her United States. Founded 16years after the arrival of the Pilgrim at Plymouth, the university has grown from 9 students with a single master to the present enrollment of more than 18,000students, including undergraduates and students in 10 graduate and professor schools. Over14, 000 people work at Harvard, including more than 2,000 faculties. Harvard has produces six presidents of the United States and 34 Noel winners.During its early years, Harvard offered a classic academic course based on the model of English universities, but consistent with the prevailing Puritan philosophy. Although many of its graduates became ministers in Puritan church throughout New England, the university never formally affiliated with a specific religious group.Under President Pusey (1953-1971), Harvard started what was then the largest fund-raising campaign in the history of American higher education. It was an 82.5 million dollar program for the university. The program increased faculty salaries, broadened student aid, created new professorships, and expandedHarvard’s physical facilities.Neil L. Rudenstine took office as Harvard’s 26th president in 1001. As part of an overall effort to achieve greater coordination among the university’s school and faculties, Rudenstine encouraged academic planning and identified some of Harvard’s main intellectual priorities. He also stressed the important of the university’s excellence in undergraduate education, the significance of keeping Harvard’s doors open to students from families of different economic backgrounds, the task of as aping the research university to an era of both rapid information growth and serious fund shortage.1.What is main idea of the passage?2.How many teachers did Harvard have at the very beginning?3.What was the relationship between Harvard University and religion during its early years?4.Which of the following is NOT mentioned as an achievement of President Pusey’s fund-raisingprogram?5.What did President Rudenstine do?Keys: 1.B 2.A 3.C 4.D 5.DViewing and speakingScriptHost: Well, David Lammy, the University Minister, joins me from Westminster. Now thanks for joining us this lunchtime, Mr. Lammy. How do these cuts_ tie in with your much trumpeted commitment to increasing higher education?Interviewee: Well, I think it's important to remind viewers that we will spend well over 12 billion pounds on higher education this year and to also say that there will be more students at university next year than ever before in our history. But what is important is that when they get to university, is that they have good facilities, good buildings, that they have good contact with their lecturers and, for students from poorer backgrounds that they receive a grant. And you know 40 percent of students who are going to university are in receipt of some grants. So we have to plan. . .Host: But there's going to be less money next year. That's the bottom line, isn't it?Interviewee: Er, we are asking universities to make a one percent cut in their teaching grant. That's 51 million out of a total budget of over five billion. Look, I think there are families across the country preparing for Christmas spending a bit less and they're, you know, it's a lot more than one percent that they're, they're feeling. So I think this is reasonable to ask universities if we are to ensure that we can continue to send more young people to university and we remain committed to that. Host: And briefly, what about these two-year degrees? This is a reduction in standards, isn't it? Interviewee: Well, we, we, we. . . It's important in this country that we remember that students aren't just the classic 18- to 21-year-old undergraduates. We want mature students. We want more part-time students and over the last few years we've been growing the number of foundation degree, two-year degrees that ensure that transition into high university and high level skills. That's what we want to support and that's what we're indicating in the grant letter that we've sent to universities over the last few days.Host: OK. David Lammy, thank you so much for joining us.Interviewee: Thank you.Key(1) increasing (2) 12 (3) more (4) facilities (5) lecturers (6) poorer (7) grant (8) one (9)budget (10) less (11) young (12) classic (13) part-time (14) growing。
新标准视听说3听力答案
新标准视听说3听力答案Unit 1。
Part I。
1. B2. C3. A4. B5. A。
Part II。
6. museum7. exciting8. rainy9. interesting 10. dangerous。
Part III。
11. What does the woman want to do?12. What does the man think of the movie?13. Where does the conversation take place?14. What is the woman going to do this weekend?15. What does the man suggest the woman do?Unit 2。
Part I。
1. A2. C3. B4. A5. C。
Part II。
6. swimming7. delicious8. crowded9. comfortable 10. expensive。
Part III。
11. What does the woman want to buy?12. What is the man looking for?13. Where is the woman going for vacation?14. What does the man think of the new restaurant?15. What does the woman suggest the man do for his birthday? Unit 3。
Part I。
1. B2. C3. A4. A5. B。
Part II。
6. interesting7. boring8. exciting9. relaxing 10. delicious。
Part III。
11. What does the woman want to do this weekend?12. What does the man think of the book?13. Where does the conversation take place?14. What does the woman plan to do for her birthday?15. What does the man suggest the woman do for her vacation? Unit 4。
视听说教程3 Unit 01听力及答案
Book III Unit 01 With Alzheimer’s, you meet a lot of new peopleAims: Identifying Signal WordsBringing up Sensitive Topics; Asking for DetailsKey Words:kit: (运动队的)服装(a set of clothes and equipment that you use when playing a sport)photographic memory: 准确得惊人的记忆力mental visualization: 头脑中形成图像、意象association: 联想(a feeling or memory that is connected with a particular place , event, word, etc.) consolidation: 巩固, 加强(the act of making something strong and secure)sieve: 筛子(a wire tool for separating small objects from large objects)toast: 烤面包; 吐司(bread that has been heated and browned in toaster or an oven)check over: 检查(examine; inspect)bacon: 咸肉, 熏肉(salted or smoked meat from the back or sides of a pig, often served in narrow thin pieces) stimulate: 刺激; 促进(encourage an activity to begin or develop further)memorize: 记住; 熟记(learn words, music, etc.)characteristic: 特征, 特性chef: 厨师(a skilled cook who manages the kitchen)recipe: 食谱, 配方(a set of instructions for cooking a particular type of food)Alzheimer's disease: 阿耳茨海默氏病, 早老性痴呆病carton: 硬纸盒, 纸板箱(a box or container usually made of paperboard)cereal: 谷类食物(如麦片等)(a breakfast food made from grain and usually eaten with milk)synthesize: 合成(make something by combining different things or substances)profusely: 丰富地(exhibiting great abundance)pajamas: 睡衣(soft and loose clothes that you wear in bed)implant: 灌输(strongly fix an idea, feeling, or way of behavior in someone's mind)visualize: 设想; 想像(form a picture of someone or something in one's mind; imagine)proficient: 精通(well advanced in an art, occupation, or branch of knowledge)vaccine: 疫苗immune: 免疫的antibody level: 抗体水平mental decline: 智力下降halt: 使停止(stop)reverse: 使逆转(turn around to the opposite direction)beta-amyloid plaque: 贝塔-淀粉状蛋白血小板molecule: 分子undergo: 经历(go through)II. Listening SkillsQuestion 1W: OK, it's your turn to pay the bill. I paid last time.M: What? You have a selective memory. You tried to pay last time, but your credit card failed; so I ended up paying!It's definitely your turn.Q: What is true according to the conversation?Key: CQuestion 2M: I'm having real trouble reviewing for this French exam. I just can't memorize all the vocabulary.W: Me too, I hate having to learn things by heart. I guess we just have to keep reading the texts over and over.Q: What does the woman prefer?Key: DQuestion 3W: Oh look! There's that guy we saw last week, playing football in the park! He looked great in his kit, remember? M: Him? I don't remember him. I've got a terrible memory for faces. I have a hard time even recognizing people I've been introduced to.Q: According to the conversation, what is the man's problem?Key: AQuestion 4M: Why is there a big sign on the back of your door that says "keys"?W: It's to remind me to take my keys when I go out because I'm always locking myself out by accident! It doesn't help though. Now I just forget to read the sign.Q: Why is there a sign on the back of the door?Key: BQuestion 5M: That history exam was really hard. The essay question was terrible!W: I know, I wish I were like David. He has a photographic memory, you know.How useful that would be!Q: What is true of David?Key AIII. Listening InTask 1: Is your memory in good shape?M: Tell me your secret. You're suddenly getting excellent marks in every subject, and you used to be a bottom-of- the-class student just like me.W: Simple enough. I read an article in a scientific journal that linked studying with remembering, based on recent research into the brain.M: Aw, that stuff's old hat: study at the same time every day, be sure your clothes are comfortable, make sure you have enough light, blah-blah-blah.W: Not so fast, wise guy. I'm talking about principles like "Mental Visualization", creating a picture in your mind of what is to be remembered.M" OK, that does sound different. Is "Association" a principle--you know, you connect what you want to remember with something you're familiar with?W: Right on! "Consolidation" is another. I review my notes right after class and consolidate---or absorb--the new material into what I've already learned.M: You're moving ahead fast with those principles. I swear this weekend I'm going to study sixteen hours a day both Saturday and Sunday.W: Whoa, big guy. That's not the way. Follow the principle of "Distributed Practice". Shorter study sessions distributed over several days are better.M: That system is all very well for you; you've got a good memory. But what about me? I've got a memory like a sieve.W: You're too modest. There's nothing wrong with your memory. But memory is like a muscle; it needs exercise.And don't forget it.Key: While the man is wondering why the woman is suddenly getting excellent marks, she says she read an article on studying and remembering. It talks about principles like "Mental Visualization", that is, creating a picture in one's mind of what is to be remembered. This reminds the man of the principle of "Association", which means connecting what one wants to remember with something one is familiar with. Then the woman adds theprinciple of "Consolidation", or reviewing one's notes after class and absorbing the new material into what one has already learned. When the man promises to study six-teen hours a day, the woman recommends the principle of "Distributed Practice", which favors shorter study sessions distributed over several days. Finally, the woman tells the man that memory is like a muscle, and that it needs exercise.Task 2: You forgot my toast!An 80-year-old couple was having problems remembering things, so they decided to go to their doctor to see what was wrong with them. They explained to the doctor about the problems they were having with their memory. After checking the couple over, the doctor told them that they were physically okay but might need to start writing things down to t~elp them remember. The couple thanked the doctor and left.Later that night while watching TV, the old woman said to the old man, "Honey, will you please go to the kitchen and get me a dish of ice cream?"Before the old man left, she added, "Why don't you write that down so you won't forget?""Nonsense," said the husband, "I can remember a dish of ice cream !""Well," said the wife, "I'd also like some strawberries on it. You'd better write that down because I know your memory is failing.""Don't be silly," replied the husband. "There're only two things: a dish of ice cream and some strawberries. I can surely remember that!"With that, he rushed into the kitchen. After about twenty minutes he returned from the kitchen and handed her a plate of bacon and eggs.The wife took one look at the plate, glanced up at her husband, and said, "Hey, you forgot the toast!"F 1. The couple went to their doctor to have a complete physical checkup.T 2. At first the wife asked the husband to get her only ice cream.F 3. The husband refused to write a note, for he believed he could remember the toast.F 4. Finally, the husband brought the wife both ice cream and strawberries.F 5. The wife blamed the husband for forgetting to bring her ice cream and strawberries.For Reference1. He thought he could remember two things--a dish of ice cream and some strawberries.2. She took one look at the plate, glanced up at him, and blamed him for forgetting her toast.Task 3: Memory-Improving TechniquesThere are many techniques you can use to improve your memory. Some of them are introduced here.First and foremost, you need to stimulate your memory all the time. To put it simply, you should use your memory as much as possible. It is especially important to try to learn something new. If you work in an office, learn to dance; if you are a dancer, learn to deal with a computer; if you work with sales, learn to play chess; if you are a programmer, learn to paint. These added activities stimulate the brain so that it continues to function.Older people need to pay attention to things they are dealing with. Don't try to memorize everything that catches your attention; focus on what you consider important. For example, you can take any object such as a pen and concentrate on it. Think on its various characteristics: its material, its function, its color, and so on. Don't allow any other thought to occupy your mind while you are concentrating on that pen.Another method that can be used is to relax yourself. It is impossible to remember things if you are tense or nervous.So, try holding your breath for ten seconds, and then release it slowly.Association is also a powerful tool to develop your memory. For example, if you cannot remember a person's name, you can think about a special feature of his face and then link it with his name.Questions:1. What seems to be an especially important way to stimulate one's memory?A) Learning different things.2. What seems to be the best way to focus your attention?C) Concentrating only on what is important.3. How can you concentrate on a pen?D) You can focus on its features.4. How can you relax yourself according to the passage?B) You can stop breathing in for a short time, and then breathe out slowly.5. What is the main idea of the passage?D) Memory-developing skills.For ReferenceStimulating one's memory, paying attention (or focusing/concentrating one's attention), relaxing, and making associations.IV. Speaking OutMODEL 1 It slipped my mind!Amy: I sent out the invitations to the dinner party.Bill: That's good. Now what should we do?Amy: We've got to plan the menu.Bill: Oh, that's right. Do you have anything in mind?Amy: I think I'm going to make the chicken salad we had at the Christmas party. Remember I asked the chef for the recipe?Bill: Yeah, but did you forget that Linda doesn't eat chicken?Amy: Linda? Oh, my gosh! I forgot to invite Linda! It just slipped my mind. She'll be mad at me.Bill: Well, everyone forgets something sometimes. It's not too late yet. I'll make a phone call. Don't worry.Amy: Thanks! You see, I'm getting forgetful. I think I'm getting old!Bill: Looks like you are, sweetheart.Now Your TurnSAMPLE DIALOGA: I'm going to throw a party, and I've sent out the invitations to my friends and relatives.B: That's good. But don't forget to invite everyone you should invite.A: I think I've invited everyone. Do you have anybody in mind?B: Did you invite John? He's lost his job after a recent quarrel with his boss.A: Oh, my gosh! I forgot to invite him! He'll be sad, thinking we look down on him. He just slipped my mind.B: Well, everyone forgets something sometimes. Don't worry. It's not too late. Make a phone call right away.A" Did I forget anybody else that I should invite?B: There's yet another person you should invite--Julia. She's just moved to the city and feels lonely.A: Oh, good heavens, I forgot all about her. She's our new friend. You see, I'm getting forgetful. I think I'm getting old!B: Looks like you are, buddy. You'd better start writing things down if they're important.MODEL 2 I can’t think of it off the top of my headJohn: Hey, Sue. Do you know what Jack's home phone number is?Susan: I can't think of it off the top of my head. I don't have my address book on me, and I don't have my mobile phone with me, either.John: That's too bad! I've got to find him now. It's urgent! If I can't find him today, I'll be dead!Susan: You might want to look it up in the phone book.John: I've checked already, but it seems that his phone number is unlisted.Susan: Maybe it's under his roommate's name.John: Well, I guess so.Susan: Well, why don't you call Jane? She has his phone number.John: I've tried, but no one answered!Susan: Maybe call his office and ask his secretary.John: I've already tried. She won't tell me. She says it's private.Susan: Oh, that's right. They usually don't release private information over the phone.John: It's a pity. You usually have a powerful memory, but you can't help today. What's wrong with you? Your memory seems to be fading early.Susan: It's not that my memory is fading. I do have a good memory for faces and names, but a poor one for numbers and dates.Now Your TurnSAMPLE DIALOGA: Hey, do you remember when is the lecture on the value of information by Professor Smith?B: I can't think of it off the top of my head. Maybe we can look it up in our notebooks, but I don't have mine with me. A: That's too bad! I don't have it with me, either. Do you remember the number of the lecture hall?B: Sorry, I can't think of it off hand.A: I'm terribly interested in the lecture. I can't miss it!B: Well, why don't you call the dean who arranged the lecture?A: I'm afraid it's not very wise to ask the dean directly.B: Then maybe you can call the office of the department and ask the secretary.A: I've already tried, but no one answered.B: Oh!A: You usually have a powerful memory, but you can't help today. Your memory seems to be fading early.B: It's not that my memory is fading. I do have a good memory for faces and names, but a poor one for numbers and dates.MODEL 3 What’s wrong with your memory?Bill: Hi, honey! My trip to London was wonderful.Amy: Tell me what thrilled you most.[The telephone rings and Bill answers it....He hangs up. ]Bill: Er, where was I?Amy: You were talking about your tour in London.Bill: Oh, yeah.Amy: I bet you had a great time.Bill: Yes, I particularly enjoyed visiting the Tower of London.Amy: How did you get there? By bus or underground?Bill: Let me see....Sorry, I can't remember any more.Amy: What's wrong with your memory?Bill: I hope it's not Alzheimer's disease. I don't want to forget my own name.Amy: I don't think so. Perhaps it's just temporary forgetfulness. You'll be all right after a good sleep.Bill: I hope so. But as this is happening so often recently, I think I must go to see a doctor and get some pills. Amy: It's not as serious as that. Anyway, I wish you had a good memory for happy events, and a bad one for unhappy things.Now Your TurnSAMPLE DIALOGA: Hey, my trip to Beijing was fantastic.B: Tell me what interested you most.[The door bell rings and A answers it....A comes back.]A: Well, where was I?B: You were talking about your tour in Beijing.A: Oh, yeah.B: I bet you had a great time.A: Yes, I particularly enjoyed visiting the Forbidden City and the Great Wall, though the admission fees were a bittoo high for me.B: What were the fees?A: Let me see....Sorry, I can't remember any more.B: What's wrong with your memory?A: I hope it's not Alzheimer's disease. I don't want to see a lot of new people everyday.B: I don't think so. Perhaps you only forget things momentarily. You'll be all right after a good sleep.A: I hope so. But as this happens so often recently, I think I have to go to see a doctor.B: I don't think it's so serious. Anyway, a bad memory helps you to forget your troubles.V. Let’s TalkHow to improve your MemoryStudent: Professor, thank you for granting me this interview. I'm Susan, a reporter from the Student Union magazine. Many students have difficulty memorizing things. Since you're an outstanding psychologist, could you give us some tips on how to improve our memory?Professor: Well, some people have better memories than others, but that's largely because they are better at creating mental images.Student: If I'm not good at creating images, what can I do?Professor: Practice helps. And the mind remembers things better if they are connected with other images. For example, if you have to pick up several items at the grocery store, say, carrots, eggs, bananas, and milk, you can create a picture in your mind of a giant carrot, and hanging from it, a banana.Student: Then I could have a giant milk carton pouring milk over the carrot and banana.Professor: Certainly. Then what would you do with the egg?Student: Hmmm. I'd visualize an egg-shaped UFO flying across the sky.Professor: There you go. The more you apply the ideas, the easier it gets. Besides creating pictures, there's another technique that is very useful.Student: What is it?Professor: Establishing an association. Suppose you are looking for lost keys. Relax, and let your mind look for all the images connected with those keys -- their feel, the sounds they make.Student: How will that help?Professor: You might remember the sound the keys made when you placed them in a drawer or the cold touch of the keys in your jacket where you left them.Student: Oh my gosh! I have to run. It's time for my English class. I see an image of my teacher staring at my empty seat in the classroom. Many thanks, Professor.Professor: Not at all, and good luck with your memory.VI . Further Listening and SpeakingListeningTask 1: The role Memory Plays in Our LifeSince memory plays a significant role in our life, scientists are increasingly interested in research on how to improve memory. Here are some factors they believe to be important in expanding memory capacity. To begin with, you must take special care in your daily life. Food for example, is very important. Some vitamins are essential for your memory to work properly. They are found in bread, cereal, vegetables and fruits. Some experts say that synthesized vitamins improve memory, but others have doubts about this, arguing that the studies have not confirmed they do work. Another essential factor is water. It helps to maintain the memory systems, especially in older persons. According to Dr. Rosewell, lack of water in the body has an immediate and strong effect on memory; it can cause confusion and other thought difficulties. Sleep also plays a significant role. To be able to have a good memory, we must allow the brain to have plenty of rest. While sleeping, the brain no longer controls the senses, and starts to revise and store the information one has received. Lack of sleep would make one feel exhausted and would weaken one's ability to concentrate. Also, one's ability to store information would be affected.Keys:1. What is the passage mainly about?A) Factors related to memory development.2. Why are foods important in promoting memory according to the passage?B) They contain vitamins.3. To whom is water especially important in maintaining the memory system?D) Older people.4. What problem can a lack of water cause?D) All of the above.5. Why is sleep important to memory?C) Sleep helps the brain to revise and store information.Task 2: Where did the professor go?This is a true story, which happened to friends of ours in a small town in South Africa. They were a hospitable couple who often entertained their neighbors for drinks, tea or dinner. On this particular spring night, they had invited a retired professor to supper. During the evening, it began to pour with rain, and the heavens really opened. Because he had walked there, they offered to put him up for the night. They pointed out that by staying overnight, he did not need to go out in the bad weather. He agreed on the soundness of that idea, thanked his hosts profusely, and the matter seemed to be settled. But while they were washing the dishes after supper, the forgetful professor disappeared. No one could find him anywhere. Eventually, after about 40 minutes, the front door bell rang. There was the professor, soaked to the skin. When he was asked what on earth he had been doing in the rain, he replied that because he was going to stay there overnight, he had gone home to get his pajamas and toothbrush.Task 3: How to Remember NamesYou just called the TV repair shop, and the voice on the other end of the line tells you, "This is Don Smith". About 5 minutes later you tell your wife that "this guy" will be out to fix the TV in the morning. You can't think of his name although you know he mentioned it on the phone.This happens all the time to just about any of us unless we have learned to concentrate and implant a name in our memory, right at the time we hear it. To do this, you must make a habit of repeating the name back to the person. This action will remind you to store the name in your "memory bank" each time you hear someone's name, and within a short time the "repeating" process can be discontinued.When you meet someone in person, use the same procedure, and in addition, visualize something different, unusual or ridiculous about his or her appearance, position, or actions that "ties in" with his or her name. Later, you may write the descriptive information on one side of a card and the name on the other side. Look at it repeatedly, see the "picture" in your mind's eye as you look at the name; or when you see the name, visualize the "picture" you haveassigned to the name.Getting this system to work will require changes in your thinking, and it may take several days or several weeks to become proficient.For Reference1. Maybe we can't think of the name.2. We can repeat the name back to the person.3. We can repeat the name. In addition, we can visualize something different, unusual, or ridiculous about his or her appearance, position, or actions that "ties in" with his or her name.4. The descriptive information on one side of the card and the name on the other side.5. We can look at it repeatedly, see the "picture" in our mind's eye as we look at the name; or when we see the name, visualize the "picture" we have assigned to the name.News Report: A Dolphin ExhibitionA recent art exhibition in Florida honored the animal often seen as man's most intelligent friend, the dolphin. The "Dolphins on Parade" exhibition in the Florida Keys featured life-sized decorated dolphin paintings made of wood and other materials. The dolphins were shown at area businesses and along the beach. Sponsors paid U.S.$750 to cover the artists' fee and the cost of materials.There were more than 100 dolphin themes, including a beer-belly dolphin. They showed the work of local artists, as well as the beach atmosphere the Keys are famous for.Probably the most unique was special because of its artist, Pandora. Pandora the dolphin painter is a real dolphin, at the Dolphin Research Center, in Marathon, Florida. The playful artist streaks colors across a dolphin painting, holding a brush in its mouth.The exhibition was held by the Monroe [Florida] Council of the Arts as part of a plan to make the Keys an international arts center. The paintings were to be auctioned off in March, with the money earned going to community art programs.。
视听说iii原文和答案unit1
VLS B3 Unit 1II. Basic Listening Practice1.ScriptW: Have you chosen your elective for next semester yet Are you taking French writing againM: Yes I am, but it’s compulsory for us next semester. So I think I’m gong to do marketing as an elective instead.Q: Which class will the man choose as his elective2.ScriptM: Did you go to that businesses lecture on Friday I missed it and need to copy your notes.W: I’d say you could borrow my notes, but Sarah’s got them. Be careful not to miss Professor Brown’s seminar; he takes attendance in that.Q: What is the woman telling the man3. ScriptW: Wow, Steven! In the library! What brings you hereM: I’m enjoying the view. All the girls in fashion design are here are preparing for an exam on Monday. Q: Why is the man in the library4. ScriptW: How’s your group doing with this statistics presentation Mine’s terrible.M: Yeah, mine too. David and Mike are OK, but Steven doesn’t pull his weight and Suzie’s never around. I don’t see how we can pass unless Steven and Suzie realize that this is their last chance.Q: What is the true of Steven and Suzie5. ScriptW: You took an MBA at Harvard Business School, didn’t you What’s it likeM: It’s expensive, about . $ 40,000 a year, plus the costs of food and housing. But the teaching is first class. The professors have a lot of practical experience. They use the case system of teaching; that is, you study how actual businesses grew or failed.Q: Why is he MBA teaching in Harvard Business School first class, according to the conversationKeys:III. Listening InTask1: On the First DayScript(Voice-over: Harison meets Jenny before the first class.)Harrison: I'm Harrison. Good to meet you.Jenny: Good to meet you. I'm Jenny.Harrison: So, you've bought the books for this biology class.Jenny: Yeah. I think everyone had to before class started. 'Harrison: No. Usually no one does much on the first day because it's still add-drop.Jenny: What's thatHarrison: Changing from class to class to find out which is best.Jenny: Have you had this teacher before I've heard he is really good.Harrison: He's good if you're a hard worker. He expects a lot.Jenny: Oh, I guess that's good. I hope I can keep up with everyone else in the class. Maybe I need your help after class.Harrison: You're welcome.(Voice-over: Jenny catches up with Harison after the first class.)Jenny: Harrison, wait up!Harrison: So what do you think of the professor's lectureJenny: I think about half of what he said went over my head.Harrison: Don't worry. A lot of what he said is explained in the reading.Jenny: Hey, would you mind if I borrowed your notes tonight to look them overHarrison: No problem. We don't have class until Wednesday. Here you go.Jenny: Thanks. I just want to make sure I'm prepared for the seminar.Harrison: Yeah. Participation in the discussion is an important part of the education here.Key(1)the first day (2)changing (3) really good (4) hard workers (5) went over her head(6) explained (7)notes (8)Wednesday (9) participation (10) educationTask 2: How to select elective coursesScriptConsider these tips on elective courses and you'll choose those that will serve you best.To begin with, you should select the courses that fit your profession. It is a good idea to choose elective courses closely related to your chosen profession. Potential employers will appreciate every bit of extra training and knowledge that they don't have to give you. For example, you may select elective courses in chemistry, biology or even physics if you are doing a science major. For business majors, select electives in accounting, business administration, and even computing, as you'll never know when these will come in handy in the corporate world.Moreover, you can choose an education that includes many fields of study. If you are taking a heavy load of career-related courses, you may prefer electives that are not directly related to your major. If you receive a well-rounded education, some employers believe that you have better potential. For example, if you have courses in science along with your business degree, you could possibly win a job over someone who majored purely in business with no outside electives.Finally, you can also select a challenging elective course. Part of getting an education is learning how to learn, and elective courses should help you achieve this goal. You need not to memorize all the information from each class, but you should get a better understanding of the world. So, pick elective courses that challenge your belief system and make you look at the world in a different way. For instance, you can consider a philosophy elective if you have been told that you are a little narrow-minded.Key(1) extra training (2) chemistry(3) accounting (4) many fields of study(5) better potential (6) business degree(7) challenging (8) how to learn(9) better understanding (10) narrow-mindedTask3: How to Get Straight A’sScriptIt is interesting to note how straight A students achieve academic excellence. Here, according to education experts and students themselves are the secrets of super-achievers.First, they know how to set priorities. Top students allow no intrusions on study time. Once the books are open or the computer is turned on, phone calls go unanswered, TV shows unwatched, snacks ignored. Study is business, and business comes before recreation.Also, good students can study anywhere and everywhere. Claudia Hill, an Arizona State University business professor recalls a cross-country runner who worked out every day. Hill persuaded him to use his spare time to memorize biology term. Then he posted a list of biology terms on the mirror in the bathroom. He learned a few terms every day while brushing his teeth. Eventually, he scored high on the final examination.Moreover, top students schedule their time well. Study times are strictly a matter of personal preference. Some work late at night when the house is quiet. Others awake early. Still others study as soon as they come home from school when the work is fresh in their minds. All agreed, however, on the need for consistency. A student says, “Whatever I was doing, I maintained a certain period of time every day for studying.”Another important characteristic of super-achievers is that they know hoe to read, According to a book entitled Getting Straight A’s, the secret of good reading is to be “an active reader-one who continually asks questions that lead to a full understanding of the author’s message”.1.Which of the following is NOT mentioned about super—achievers starting to study2.What did the runner do to score high on the exam3.What is the good thing all top students agree on4.What does the speaker mean by “an active reader”5.What is the main idea of the passageKey: 1B . DIV. Speaking OutMODEL 1 Y ou’re just going to have study hardNora: Only our first day back at school, and already I feel like I’ve learned a lot.Chris: Only our first day back at school, and I already feel like I’m up to my ears in homework.Nora: You’re going to have to hit the books if you want to keep your grades up.Chris: Tell me about it! I already have two reports, two books reports, a composition, an oral report, anda research project—all due before midterms.Nora: We could work together. Maybe some of my organized study habit would rub off on you.Chris: Better yet, maybe you could do my homework for me.Nora: Forget it! That would be cheating.Chris: All right, all right. I have yet to write a term paper. Can you recommend any articles and books You’d better find me the exact pages where I can find what I want.Nora: You could borrow ideas from references, but if you quote without giving the sources, you’re plagiarizing.Chris: The quiz next week will be a headache. If you don’t help me, I’ll have to prepare some study sheets and hide them in my hand when I take the test.Nora: Oh, no! If you’re caught, the professor will definitely give you an F. Probably, you will have to repeat the year.Chris: All right, I’ll take your advice. The library is going to be my new home, and in the dorm I’ll be burning the midnight oil.MODEL2 Which class do you preferScriptChris: First period is math with Mr. Woods. I don’t know how am I going to stay awakeNora: I like Mr. Wood. He’s interesting.Chris: He’s boring! He could put the entire basketball team to sleep—during the championship game!Who do you have for economicsNora: Mrs. Jenkins. She’s smart. Students really learn a lot from her.Chris: She’s tough! You have to work hard in her class, or you’ll probably fail.Nora:No pain, no gain.Chris: Nonsense, You could have learned even more with Mr. Sharp. But not many students opt for his class.Nora: What’s wrong with himChris: Often, the highest grade he gives on a term paper is C+, and he usually fails half of the students. Nora: No wonder he’s got the nickname Mr. Shark. Well, how about PE What are you doing this semester Chris: That’s the worst part. In PE, we’re learning t’ai chi. I’m bored to death.Nora: Ha-ha! Not to rub salt into the wound, but our class is playing your favorite sport: basketball. Chris: Oh…that figures! This is going to be a terrible semester.Nora: This is going to be a great semester!MODEL3 Publish or perishScriptChris: Tell us, Professor Grant, What are your primary duties as a professorProfessor Grant: Well,I do a lot of research and writing.It’s rough being an associate professor. It’s publish or perish.Chris: So you spent a lot of time in your officeProfessor Grant: Yes, but I also have to prepare class motes, give lectures, hold office hours. Teaching is an important part of being a professor.Chris: With all those responsibilities, you must make a lot of money.Professor Grant: I wish. Actually, I spend a lot of tome applying foe grants to fund my research. Then I can offer assistantships and scholarships to the worthy graduate.Chris: I see why they call you “the boss”. But being a professor sounds pretty competitive. Professor Grant: Actually, I think you were in one of my classes…Chris: Um….I think you’re mistaken, Professor Grant!Professor Grant: No, I remember very clearly now! You owe me an essay!Chris: Sorry, I have too much work to do for the Student Union Newsletter, and I have to work two jobs to pay for school.Professor Grant:So you get an F in this course.V. Let’s TalkInterviewee: It's a really difficult balance to strike, actually maintaining the (1)quality but making sure as many (2)young people as possible and older people as well-there's been a surge in the number of over 25s applying, andwe take many people who are over (3)25. But we've got to get that balance right. It's going to be terribly(4)difficult for us next year.Hostess: Given the cuts that the (5)government announced a couple of weeks ago, and the numbers that we know in terms of applications, where are you going to draw that line Are you going to have to look at cuttingintake in order to maintain the (6)quality of the coursesIntewiewee: We're trying not to (7)cut intake at the moment. But what it means is we're going to have to be(8)extra-cautious in the number of offers we make, because we simply cannot (9) afford to go over ourquota of the number of places that we can offer. Because if we do, it means that we could be fined, or wejust simply haven't got enough money to make sure the students' (10)experience is right. So it means thatmaybe last year we would allow a few (11) more people to have an offer. This year is going to be tougher. Hostess: Do you lay some of the (12)blame for the situation at the door of the governmentInterviewee: If you look to France, Sarkozy is actually increasing the (13)budget for higher education.Obama in the . has done the same thing. So we're just slightly (14)puzzled as to why the governmentseems to- be cutting back on higher education rather than pumping more money into what we think is a(15)service that is absolutely vital for the economy.VI. Further Listening and SpeakingTask1:ScriptHi, everybody. My topic today is “Problems with Our Educational System”.There are a lot of things in our educational system that I don’t agree with. It seems that educators just want to give standardized tests, which focus only on academic performance but neglect students’ abilities and interests in other areas. I think there’re a lot of people who are very intelligent, but haven’t had the opportunities they could’ve had,had they been educated in a broader-minded educational systems. I feel that a lot of courses that students are focused to take in high school are too academic, and, as a result, many kids lost their interest in learning.Educators have failed to recognize various kinds of intelligence. They often exert a lot of pressure on students to be as well-rounded as possible. I think being well-rounded isn’t really possible. And as a consequence some students who are believed to be intelligent can’t get into good colleges if they, for example, haven’t scored well on the math section, even if they ate brilliant writers.Another thing that disturbs me is that the so-called “weak students” are separated from the rest of the school. Some kids are kept in a separate class id their grades are lower then others. And they’ve very aware of their social position, you know. I think it causes them to act in a way that is not really positive. They’re just acting in a way that they are expected to act. Often their grades go from bad to worse. And that’s pretty sad to me. I think that many of the kids in those classed are intelligent, but never actually realize their potential because of the way they are treated very early on in their education.Key(1) standardized tests (2) abilities and interest (3) interest (4) pressure(5)well-rounded (6) get into good colleges (7) the rest of the school (8) from bad to worse Task 2: The Final ExamScriptAt a university, there were four sophomores taking a chemistry course. They were doing so well on all the quizzes, midterms, labs, that each had “A” so far for the semester.These four friends were so confident that on the weekend before finals, they decided to go up to theUniversity of Virginia and party with some friends there. They had a great time, but after all the hearty partying, they slept all day Sunday and didn’t make it back to school until early Monday morning. Rather than taking the final then, they decided to find their professor after the final exam and explain to him why they missed it. They explained that they had planned to come back in time for the final exam, but, unfortunately, they had a flat tire on the way back, didn’t have a spare, and couldn’t get help for a long time. As a result, they missed the final.The professor thought it over and then agreed they could make up the final the following day. The guys were relieved and elated. The next day, the professor placed them in separate room, hand each of them a test booklet, and told them to begin.They took at the first problem, worth five points. It was a simple question on a chemical reaction. “Cool,”they thought at the same time, each one in his separate room, “This is going to be easy.” Each finished the problem and then turned the page.On the second page was a question worth 95 points: “Which of the tires was flat”Task 3 Harvard UniversityScriptHarvard University is the oldest institute of highest learning in her United States. Founded 16years after the arrival of the Pilgrim at Plymouth, the university has grown from 9 students with a single master to the present enrollment of more than 18,000students, including undergraduates and students in 10 graduate and professor schools. Over14, 000 people work at Harvard, including more than 2,000 faculties. Harvard has produces six presidents of the United States and 34 Noel winners.During its early years, Harvard offered a classic academic course based on the model of English universities, but consistent with the prevailing Puritan philosophy. Although many of its graduates became ministers in Puritan church throughout New England, the university never formally affiliated with a specific religious group.Under President Pusey (1953-1971), Harvard started what was then the largest fund-raising campaign in the history of American higher education. It was an million dollar program for the university. The program increased faculty salaries, broadened student aid, created new professorships, and expanded Harvard’s physical facilities.Neil L. Rudenstine took office as Harvard’s 26th president in 1001. As part of an overall effort to achieve greater coordination among the university’s school and faculties, Rudenstine encouraged academic planning and identified some of Harvard’s main intellectual priorities. He also stressed the important of the university’s excellence in undergraduate education, the significance of keeping Harvard’s doors open to students from families of different economic backgrounds, the task of as aping the research university to an era of both rapid information growth and serious fund shortage.1.What is main idea of the passage2.How many teachers did Harvard have at the very beginning3.What was the relationship between Harvard University and religion during its early years4.Which of the following is NOT mentioned as an achievement of President Pusey’s fund-raisingprogram5.What did President Rudenstine doKeys:Viewing and speakingScriptHost: Well, David Lammy, the University Minister, joins me from Westminster. Now thanks for joining us this lunchtime, Mr. Lammy. How do these cuts_ tie in with your much trumpeted commitment to increasing higher educationInterviewee: Well, I think it's important to remind viewers that we will spend well over 12 billion pounds on higher education this year and to also say that there will be more students at university next year than ever before in our history. But what is important is that when they get to university, is that they have good facilities, good buildings, that they have good contact with their lecturers and, for students from poorer backgrounds that they receive a grant. And you know 40 percent of students who are going to university are in receipt of some grants. So we have to plan. . .Host: But there's going to be less money next year. That's the bottom line, isn't itInterviewee: Er, we are asking universities to make a one percent cut in their teaching grant. That's 51 million out of a total budget of over five billion. Look, I think there are families across the country preparing for Christmas spending a bit less and they're, you know, it's a lot more than one percent that they're, they're feeling. So I think this is reasonable to ask universities if we are to ensure that we can continue to send more young people to university and we remain committed to that.Host: And briefly, what about these two-year degrees This is a reduction in standards, isn't it Interviewee: Well, we, we, we. . . It's important in this country that we remember that students aren't just the classic 18- to 21-year-old undergraduates. We want mature students. We want more part-time students and over the last few years we've been growing the number of foundation degree, two-year degrees that ensure that transition into high university and high level skills.That's what we want to support and that's what we're indicating in the grant letter that we've sent to universities over the last few days.Host: OK. David Lammy, thank you so much for joining us.Interviewee: Thank you.Key(1) increasing (2) 12 (3) more (4) facilities(5) lecturers (6) poorer (7) grant (8) one(9)budget (10) less (11) young (12) classic(13) part-time (14) growing。
新标准大学英语_视听说教程3 U1-U6单元 原文及翻译
Unit1Inside ViewConversation1Janet:Hi,it’s me again,Janet Li.I’m still a student at the University of Oxford in England.But I’m not in Oxford right now.And I haven’t gone back home to China either.It’s the long vacation now,and believe it or not,it’s the middle of summer.I’m spending my summer in one of the world’s greatest cities.I’m in London,home to the Houses of Parliament,Big Ben,Tower Bridge…and the double-decker bus.I want to find out what it’s like to live in this busy,lively city.So I’m working for London Time Off,a website about what’s on in London.This is Joe…,he’s my boss,and this is Andy, who is a reporter.And what’s my job?Well,I don’t know yet,because it’s my first day.But I’m meant to be shadowing Andy,oh,what I mean is,I’m going to be helping him.So can you tell me something about London,Andy?Andy:It’s the greatest city in the world..Joe:Except for New York!Andy:New York?Don’t make me laugh!Joe:And your point is…?Andy:Look,if you want my opinion,London is greater than New York…Joe:No,I don’t want your opinion,thank you very much.It’s a fact.Andy:A fact!Are you serious?\Janet:And here we are in London,probably the greatest city in the world.Andy:What?Probably?Excuse me,I prefer to deal with this myself…Joe:Ah,dream on,Andy………珍妮特：嗨，又是我，珍妮特.李。
新编大学英语视听说3Unit1听力原文和答案
3Unit1 听新编大学英语视听说力原文和答案Unit 1Part OneListe ning IIn terviewer: An gela, you were born in Korea but you've been living in Canada for a long time, have n't you?An gela: Yes, I was 10 years old whe n my pare nts immigrated to Can ada and「ve bee n livi ng here for 20 years now.In terviewer: Do you thi nk that bel onging to two differe nt cultures has affected your pers on ality? Angela: Yes, definitely. There are times when I think that I have two pers on alities. Depe nding on where I am and who「m with, I'm Korea n or 「m Can adia n.In terviewer: That sounds complicated. Could you expla in what you mean?An gela: Well, grow ing up in Can ada whe n I was going to high school, for example, I was known as An gela to the outside world, and asSun-Ky ung at home. I would wave hello to my teachers, but bow to my pare nts' Korea n frie nds whe n they visited our home.In terviewer: Do differe nt cultures have differe nt ideas as to what is polite?An gela: Yes, defi nitely .In high school, I was expected to look straight in the eyes of my teachers and to talk ope nly with them. But whe n Korea ns spoke to me, I was expected to look at my feet and to be shy and sile nt.In terviewer: Do you thi nk that hav ing two pers on alities makes you a richer pers on?An gela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello4) bow5) look straight in the eyes of 6) ope nly 7) look at my feet8) shy and sile ntListe ning III am a very sen sitive pers on, and that's good to a poin t. I feel every one should be able to feel or un dersta nd what others are going through. But whe n you suffer and cry for people you don't know, or over a movie that s 6nly a story, then I think that's a little too sen sitive. That's the way I am.I am also a very in depe ndent pers on. I must do things by myself. I don't like people doing things for me, or helpi ng me, or givi ng me thin gs. It's not that I don't appreciate it. I just feel that whe n some one does somethi ng for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone any thi ng.I thi nk I would be a good frie nd. I would do almost any thi ng for some one I like; and I would share orgive any thi ng I have. I'm very cari ng and understanding. People trust me with their secrets, and they're right for doing so because I n ever tell others any secret that is told to me. 「m always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good.I find fun in almost everyth ing I do (except housework). I like to watch people, talk to them, and be around them. It makes no differe nee whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy lear ning and being aware of everyth ing and every one around me.Exercise 11. sen sitive/ cari ng in depe ndent / un dersta nding2. good friend3. life people4.learning being awareExercise 21. B2. C3. A4. D5. BListe ning IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Ci ndy and I are going ice-skati ng on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for n ext week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cin dy's sister, Kristi. We could double-date. She's really outgo ing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-ce ntered. She could n't stop talk ing about how great she was. I'm not sure if I can trust you, "Mr.Matchmaker".Bill: Oh come on. So I made a mistake last time. Ci ndy's sister is really differe nt.Tom: Well, what does she look like?Bill: Ah. Looks aren't importa nt. She has a won derful pers on ality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter tha n you are.Tom: Go on.Bill: She has a great figure, a nice complexi on, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kiddi ng. By the way, she was the runn er-up in the Miss California BeautyPagea nt two years ago. Well, you're probably notin terested.Tom: No, wait!Bill: Ah, just forget I ever men ti oned it.Tom: No, I'm in terested!Exercise 11. ice-skating2. chemistry3. outgoingbright funny 4. self-ce ntered5. blond medium height6. runn er-upExercise 21. T2. F3. T4. F5. FListe ning IVDavid: Barbara, before you go, could you tell me about these stude nts that are com ing into my class?Barbara: Oh, yes. Now, let me think, well,there's…er…Paul. He's a tall, slim lad with fair hair. Very frie ndly face, lovely smile... He's particularly good with group activities, and he's a very helpfulpers on to have in the class and very helpful with the other students. He speaks flue ntly, but does make a lot of mistakes! He does n't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susa n...Susa n. Now, she's very lively, quick, and very bright. She talks all the time but not always in En glish.David: What? Is she difficult or an ythi ng? Barbara: No…she's quite young but she does behave in quite a grow n-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very ni ce. She has dark hair and dark eyes.David: Right, well…are there any other girls in the class?Barbara: Y es, there is Maria. She's Susa n's sister.David: Y es.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has Ion ger hair tha n Susan. She's not quite as bright as her sister and I thi nk that makes her feel a bit in ferior really. Well, you know, she sulks a bit whe n she gets things wrong or she misun dersta nds you. But on the whole, a very sen sible girl.David: OK.Barbara: And the n there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brow n hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determ ined to lear n as much as possible. He asks quite difficult questi ons but he does n't mean to be n asty.David: Well, tha nks, Barbara. It's all up to me now, is n't it? Have a good holiday, won't you?Barbara: Tha nks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susa n5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter AG IFurther Liste ningListe ning IOne day, whe n Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sen sible tha n his wife, so he started to give her a lecture on the importa nee of always remai ning calm.Fi nally he said, "It's a waste of your stre ngth to get excited about small thin gs. Train yourself to bepatie nt, like me. Now, look at the fly that has just Ian ded on my no se. Am I gett ing excited or anno yed? Am I sweari ng or wavi ng my arms around? No. I'm no t. I'm perfectly calm."Just as he had said this, Mr. Smith started shouti ng. He jumped up and bega n to wave his arms around wildly and swear terribly. He could n't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sen sible 3) lecture 4) calm 5)stre ngth6) Ianded 7) swearing 8) perfectly 9) wildly 10) beeListe ning IITom: Oh, that Mr. Taylor. He is so bori ng! Mother: What do you mean?Tom: His less ons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darli ng?Tom: Yes, he gets angry very quickly.Mother: That does n't sound like Mr. Taylor at all!Tom: And do you know, he spe nds all the time look ing at his reflecti on in the win dow, admiri ng himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And con ceited! He thinks he knows everythi ng.Mother: Oh, Tom. Be reas on able. I'm sure you're exaggerati ng. Mr. Taylor seems such a ni ce, kind man.Tom: Well, he isn't. He is mea n and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I un dersta nd. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7.D 8. CListe ning III1. Pedro sleeps only six hours a ni ght. He goes to school full-time and works part-time in theafter noons. At ni ght he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of pers on is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The stude nts did n't un dersta nd. He had to repeat his less on and expla in the idea more slowly. Over the next few days heexpla ined and expla ined the less on un til almost the whole class un derstood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street n eighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom.Each one saw the chair he wan ted to sit on. Unfortun ately, it was the same chair. They both sat dow n at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, the n you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of pers on is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She faste ned a basketball hoop over the wastebasket. Now the stude nts love to practice throwing their paper into the basket. When they miss, they pick the paper up and try aga in. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. MillerD patie nt3. Mr. Smith E ho nest4. Jake A stubbor n5. Mrs. Duke F creative Exercise 21. favorite way to relax2. how to divide3. bad un ripe4. stiff sore5. faste ning a basketball hoop Liste ning IVA nu mber of visitors to the UK, who had traveled throughout the British Isles, were asked by a n ewspaper reporter what their impressi ons of the British people were. Here's a brief summary of what they thought.There were many differe nt opinions among those in terviewed: Some were very flatteri ng, others very critical. The distinction between the En glish and the British was n't always un derstood, but, onthe whole, it seemed that the Scots were very popular with visitors. They were thought to be very frie ndly, eve n though one Dutch visitor con fessed she'd found it hard to un dersta nd their En glish.A great n umber found the British gen erally reserved, particularly the En glish, although one Australian visitor called the English "the frien dliest people in the world and most hospitable". But she did admit that speaking the same Ian guage was a great help.Some Asia n bus in essme n, who had traveled widely throughout En gla nd, said quite ope nly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much ni cer", one of them said, with a playful smile on his face, "By much ni cer I mea n much more like us!"A few con ti nen tals praised "En glish courtesy", but the majority found it dish on est and dull."Yo u're forever say ing 'please' and 'sorry' whe n you don't feel pleased or sorry," one expla in ed.A young stude nt from South Africa had no views on the matter. He had n't met anyEn glishme n, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scots' English 2) the friendliest people 3) much nicer than 4) En glish courtesy 5) no views on the matter/ nocomme nts on the matter。
新标准大学英语视听说教程(3)听力原文_Unit+1
Unit 1-Conversation 1**（1）Janet:So this is the Cherwell Boathouse — it's lovely! And look at those people punting! It looks quite easy.Mark:I'm not so sure about that! Janet, there's something Kate and I wanted to discuss with you. Some people in college are organizing charity events this term. We've decided to get involved.Janet:Raising money for charity? Right. In China, people raise money for charity but students don't usually do that. Mark:Students often do that here. Anyway, we're thinking of doing sponsored punting.Janet:Sponsored punting! What's that?Kate:Sponsoring is when people pay you to do something —like run a long distance. So people would be sponsoring students to punt.Janet: What a great idea! I'd love to join you!Mark:That's why we're telling you about it. So that's decided then. Let's make a list of things we need to do. Kate: I'll do that. One of the first things we should do is choose the charity.Mark: Yes. And choose a day for the event. And we need to design the sponsorship form. I've got one here.Kate:That looks fine, but we must change the wording. Who wants to do that?Mark: I'll do that. What have we got so far?Kate: Choose a charity. Also a day for the event. Change the wording on the sponsorship form... Um ... We have to decide where the punt will start from.Mark: Cherwell Boathouse, no question! It's a very beautiful route from here, apparently.Kate: I'm with you on that.Janet: Me tooJanet: I'm not used to boats — Woah!Mark: Whoops!Kate: Watch out! You nearly hit me with that thing! Mark: Sorry! I didn't mean to. ... OK, we're off!Kate: Maybe I should do the punting.Mark:It's fine.I've got the hang of it now —give me a chance. Kate: Well, I'd like to have a go.Mark: Supposing I do the first hour. Then you can take over for a while, if you want to.Kate: Yes, great.Janet: You're really good at it, Mark! This is fantastic! It's exactly how I imagined life here! Look over there —isn't it lovely!Kate: Yes, it is.Unit 1-Conversation 2Janet: Kate, everything's organized, isn't it, for collecting the sponsorship money?Kate: Yes, I've arranged for people to get the money to me by next Friday — if they haven't paid online. I'll count it all up. Janet: Good. We'd better have a meeting soon after that, don't you think? How much have we raised?Kate: About 600.Janet: Fantastic! I'm so enjoying this! Mark: Hey guys, I've got a suggestion —how about moving over to the bank and we can have our picnic! Hey, look, there's Louise and Sophie!Mark: Whoo ...Girls: Mark!Janet: Are you all right?Mark: Er .Of course I'm all right. Kate, I think it's your turn to punt!Unit 1-Outside ViewVoice-over Harvard University in Cambridge is one of the best universities in the world. We spoke to Alex Jude, the university's Head of Communications. He explained that Harvard looks for the best and most talented students from around the world.Alex Harvard actually seeks students from around the world, the best students that we can find, to study chemistry, or study literature, or study government, or business. Our business school is particularly well-known around the world, as is the medical school and law school, so, um, and, and the Kennedy School of Government, or the John F Kennedy School of Government, so, er, we do seek very, very talented students and we have open doors for them.Voice-over We asked five students at Harvard to tell us what kind of social life they have.Ashley Um, well relaxing is a little hard to do around here, but basically, I mean, I still, I, I live nearby anyway, so I see a lot of my friends, and ... Um, there's a good social life here if you look for it. I go to the gym, run. So that's what I do.Adam It's, it's whatever you want it to be. It's good. If you wanna go out party, do anything you can. If you wanna sit in your room and study all night like my friend over here, you can also do that.Brian Socially, like you said, it's, it's a lot of what you make it. Um, we don't have fraternities here, and so, you know, that's, it's obviously not as social. There's not as many parties as there would be on another campus. Um, but on a Friday or Saturday night, there, there, there will be a party. Usually we end up studying until about 10 o'clock. And then we, and then we'll go out and have fun maybe, or just watch a movie with friends, or, you know, whatever is going on for the night.Jodie Not everyone would agree with me, obviously, but it's, I think it's a fun place to be.Interviewer Have you made a lot of friends?Jodie Oh, definitely.Interviewer Mm.Jodie Many.Interviewer What, what do you do with your friends?Jodie Um, well, I like to go to concerts. I'm in three music groups, so I have lots of rehearsals during the week for that. Um, just do, you know, some fun things, onthe weekend.Voice-over We asked the Harvard students if they use the Internet.Ashley Um, I, I use it a fairly good amount. Um, ourlibrary system is online, so I use that a lot. And a lot of my classes, you know, have to do research papers. You can find a lot of information on there, so.Interviewer So how often do you use it, a week, a day? Ashley Um, I use it probably on more of a weekly basis. Maybe three or four times a week.Brian Oh yes, definitely. We live through the Internet actually. Well, I do a lot of research through the Internet, follow my stocks on the Internet. Um, well, even thoughe-mail is not officially Internet, we, that's how we communicate a lot at college, so, through the e-mail.John Um, I use the internet mostly for, er, I'd say, sort of leisure purposes. I mean, I play, um, I use it for a lot of, I don't, we don't have TV in my room, so I use it, uh, uh, go to the CNN website, keep up on current events, things like that. Uh, I also, uh, you know, there's some little games to play over the Internet. Um, just um, I go to to see what's happening, follow the Boston Red Sox, things like that. Um, I think a lot of courses use it to post things, but I, I don't usually use it that much for research, or things. I tend to use the libraries for such things, so.Unit 1-Listening inNews reportStanford University has recently changed its financial aid policy for students to make the university more affordable and accessible. Students who don’t have financial aid pay about $46,000 a year just for tuition. It’s not unusual for students to be forced to decline an o ffer because they can’t afford to go to their dream school. The new policy means that for students whose families earn less than $125,000, tuition is fully covered by scholarship and grant aid. Those with a family income below $65,000 are not expected to pay for either tuition, or room and board. This is great news for talented students who are concerned about fees.However, Stanford is not the only top university in the United States that makes tuition affordable for students. Ivy League schools, such as Harvard, Princeton and Yale, also offer free tuition plans to students from low-income and middle-class families.Stanford and Ivy League schools can offer generous financial aid packages because they are very wealthy. They receive large annual donations that can be used for specific purposes, such as financial aid.1 What has Stanford University done recently?2 How much is the tuition a year at Stanford if students don’t receive financial aid?3 Why is Stanford University so wealthy?Passage 1Voice-over Hi, I'm Nick Carter, and this is SUR, your university radio station. This morning we went around campus to ask freshers -now half-way through their first year -the question, "How are you finding uni?" Here are some of the answers we got.Speaker 1It's cool. It's everything I hoped it would be. I'm very ambitious, I want to be a journalist and I want to get to the top of the profession. I've started writing for the university newspaper so I've got my foot on the ladder already. Speaker 2I'm working hard and the teaching is as good as I expected. And I've made some good friends. But I'm very homesick. I'm Nigerian and my family's so far away. I went home at Christmas for a month -that really helped, but man, I miss my family so much.Speaker 3"How am I finding uni?" It's great. It's not perfect, nothing is, but, like, I've got a brilliant social life, just brilliant, and I've made lots of friends. For the first few months I just didn't do, really enough work. But I -1 talked about it with my parents and I'm working harder now and getting good grades.Speaker 4Actually, I've been quite lonely to be honest. I'm a bit shy ... everyone else seemed to find it so easy to make friends straight away. But things have been better recently - yeah, they have. I've joined a couple of clubs and like, it really helps to get to know people when you have shared interests. So, yeah - I'm feeling a lot happier now.Speaker 5 Uni's great, I love it. My only problem -and it's quite a big problem - is money. My parents are both unemployed so, you know, they can't help me financially. My grant just isn't - it's just not enough for me to live on, so I've taken a part-time job as a waitress — a lot of people I know, like a lot, have had to do the same. I don't want to have huge debts at the end.Speaker 6I love my subject. History, and I'm, I'm getting fantastic teaching here. I want to be a university lecturer and that means I have to get a first. I have a good social life but work definitely comes first for me.Passage 2Oxford and Cambridge - two universities so similar that they are often spoken of together as "Oxbridge". They're both in the UK, fairly near London, and both regularly come top in any ranking of the world's best universities.The two universities began within a century of each other. Oxford University, now 900 years old, was founded towards the end of the 11th century. In 1209 there was a dispute between the university and the townspeople of Oxford. As a result, some of the Oxford teachers left and founded a university in the town of Cambridge, some 84 miles away. Ever since then, the two institutions have been very competitive.Unlike most modem universities, both Oxford and Cambridge consist of a large number of colleges. Oxford has 39 and Cambridge 31. Many of these colleges have old and very beautiful architecture, and large numbers of tourists visit them.In all UK universities, you need good grades in the national exams taken at 18. But to get into Oxford and Cambridge, it's not enough to get A grades in your exams. You also have to go for a long interview. In these interviews, students need to show that they are creative and capable of original thinking.Through the centuries, both universities have made huge contributions to British cultural life. They have produced great writers, world leaders and politicians. Cambridge, in particular, has produced scientists whose discoveries andinventions have changed our lives.Among the great university institutions is the world's most famous debating society, the Oxford Union, where undergraduates get a chance to practise speaking in public. Cambridge's comedy club Footlights has produced many first-class comedians, while some of the UK's most famous actors and actresses began their careers at The Oxford University Dramatic Society, known as OUDS. Then there's the Oxford and Cambridge Boat Race, which takes place every year in March or April, and is watched on television all over the UK.So with all this excellence in so many fields, it's not surprising that the ambition of clever students all over the world is to attend either one of these great universities.。
大学英语视听说第3册教程答案完整版
新视野大学英语视听说教程第三册听力练习录音文本和答案Uint1- Uint10Uint1II. Basic Listening Practice1.ScriptW: Ok. It‘s your turn to pay the bill. I paid last time.M: What? You have a selective memory. You tried to pay last turn, but your credit card failed; so I ended up paying! It‘s definitely your turn.Q: What is true according to the conversation?2.ScriptM: I‘m having real trouble reviewing for this French exam. I just can‘t memorize all the vocabulary.W: Me too. I hate having to learn things by heart.I guess we just have to keep reading the texts over and over.Q: What does the woman prefer?3. ScriptW: Oh look! There‘s that guy we saw last week, playing football in the park! He looked great in his kit, remember?M: Him? I don‘t remember him. I‘ve got a terrible memory for faces. I have a hard time even recording people I‘ve been introduced to.Q: According to the conversation, what is the man‘s problem?4. ScriptM: Why is there a big sign on the back of your door that says ―keys‖?W: It‘s to remind me to take my keys when I go out because I‘m always locking myself out by accident! It doesn‘t help enough. Now I just forget to read the sign. Q: Why is there a sign on the back of the door?5. ScriptM: That history exam was really hard. The essay question was terrible!W: I know, I wish I were like David. He has a photographic memory, you know. How useful that would be!Q: What is true of DavidKeys: 1.C 2.D 3. A 4.B 5.CIII. Listening InScriptM: Tell me your secret. You‘re suddenly getting excellent marks in every subject, and you used to be a bottom-of –class student just like me.W:Simple enough. I read an article in a scientific journal that studying with remembering, based on recent research into the brain.M: Aw, that stuff‘s old hat: study at the same time every day, be sure your clothes are comfortable, and make sure you have enough light, blah-blah-blah.W: Not so fast, wise guy. I‘m talking about principles like ―Mental Visualization‖, creating a picture in your mind of what is to be remembered.M: Ok, that dies sound different. Id ―Association‖a principle—you know, you connect what you want to remember with something you‘re familiar with?W: Right on! ‗Consolidation‖is another. I review my notes right after class and consolidate—or absorb—the new material into what I‘ve already learned.M: You‘re moving ahead fast with those principles. I swear this weekend I‘m going to study sixteen hours a day both Saturday and Sunday.W: Whoa, big guy. That‘s not the way. Follow the principle of ―Distributes Practice‖.Shorter study sessions distributes over several days are better.M: That system is all very well for you; you‘ve got a good memory. But what about me? I‘ve got a memory like a sieve.W: You‘re too modest. There‘s nothing wrong with your memory. But memory is likea muscle; it needs exercise. And don‘t forget it.While the man is wondering why the woman is suddenly getting excellent marks, she says she read an article on studying and remembering. It talks about principles like ―Mental Visualization‖, that is, creating a picture in one‘s mind of what is to be remembered. This reminds the man of the principle of ―Association‖, which means connecting what one wants to remember with something one is familiar with. Then the woman adds the principle of ―Consolidation‖, or reviewing one‘s notes after class and absorbing the new materia l into what one has already learned. When the man promise to study sixteen hours a day, the woman recommends the principle of ―Distributed Practice‖, which favors shorter study sessions distributed over several days. Finally, the woman tells the man that memory is like a muscle, and that it needs exercise.Task 2: You forget my toast!ScriptAn 80-year-old couple was having problems remembering things, so they decide to go to their doctor to see what was wrong with them. They explained to the doctor about the problems they were having with their memory. After checking the couple over, the doctor told them that they were physically okay but might need to start writing things down to help them remember. The couple thanked the doctor and left.Later that night while watching TV, the old woman said to the old man, ―Honey, will you please go to the kitchen and get me a dish of ice cream?‖Before the man left, she added, ―Why don‘t you write that down so you won‘t forget?‖―Nonsense,‖ said the husband, ―I can remember a dish of ice cream!‖―Well,‖ said the wife, ―I‘d like some strawberries on it. You‘d better write that down because I know your memory is failing.‖―Don‘t be silly,‖ replied the husband. ―There‘re only two things: a dish of ice cream and some strawberries. I can surely remember that!‖With that, he rushed into the kitchen. After about twenty minutes he returned from the kitchen and handed her a plate of bacon and eggs.The wife took one look at the plate, glanced up at her husband, and said, ―Hey, you forget the toast!‖Keys: FTFFFTask3: Memory-Improving TechniquesScriptThere are many techniques you can use to improve your memory. Some of them are introduced her.First and foremost, you need to stimulate your memory all the time. To put it simply, you should use your memory as much as possible. It is especially important to try to learn something new. If you work in an office, learn to dance; if you are a dancer, learn to deal with a computer, if you work with sales, and learn to play chess; if you are a programmer, learn to paint. These added activities stimulate the brain so that I t continues to function.Older people need to pay attention to things they are dealing with. Don‘t try to memorize everything that catches your attention; focus on what you consider important. For example, you can take any object such as a pen and concentrate on it. Think on its various characteristics: its material, its function, its color, and so on. Don‘t allow any other thought to occupy your mind while you are concentrating in that pen.Another method that can be used is to relax yourself. It is impossible to remember things if you are tense or nervous.So, try holding your breath for ten seconds, and then release it slowly.Association is also a powerful tool to develop your memory. For example, if youcannot remember a person‘s name, you can think about a special feature of his face and then link it with his mane.1.What‘s seems to be an especially important way to stimulate one‘s memory?2.What seems to be the best way to focus your memory?3.How can you concentrate on a pen?4.How can you relax yourself according to the passage?5.What is the main idea of the passage?Kes: 1A 2.C3. D 4.B 5.DIV. Speaking OutMODEL 1 It slipped my mind!Amy: I sent out the invitations to the dinner party.Bill: That‘s good. Now what should we do?Amy: We‘ve got to plan the menu.Bill:Oh, that‘s right. Do you have anything in mind?Amy:I think I‘m going to make the chicken salad we had at the Christmas party.Remember I sled the chef for the recipe?Bill: Yeah, but did you forget that Linda doesn‘t eat chicken?Amy: Linda? Oh, my gosh! I forgot to invite Linda! It just slipped my mind. She‘ll be mad at me.Bill: Well, everyone forgets something sometimes. It‘s not too late yet. I‘ll make a phone call. Don‘t worry.Amy: Thanks! You see, I‘m getting forgetful. I think I‘m getting old!Bill: Looks like you are, sweetheartNow Y our TurnSAMPLE DIALOGA:I‘m going to throw a party, and I‘ve sent out the invitations to my friends and relatives.B: That‘s good. But don‘t forget to invite everyone you should invite.A: I think I‘ve invited everyone. Do you have anybody in mind?B: Did you invite John? He‘s lost his job after recent quarrel with his boss.A: Oh, my gosh! I forgot to invite him! He‘ll be sad, thinking we look down on him.He just slipped my mind.B: Well, everyone forgets something sometimes. Don‘t worry. It‘s not too late. Makea phone call right away.A: Did I forget anybody else that I should incite?B: There‘s yet another person you should invite—Julia. She‘s just moved to the city and feels lonely.A: Oh, good heavens, I forgot all about her. She‘s our new friend. You see, I‘m getting forgetful. I think I‘m getting old!B: Looks like you are, buddy. You‘d better start writing things down if they‘re important.MODEL2 I can’t think of it off the top of my head.ScriptJohn: Hey, Sue. Do you know what Jack‘s home phone number is?Susan: I can‘t think of it off the top of my head. I don‘t have my address book on me, and I don‘t have my mobile phone with me, either.John: That‘s too bad! I‘ve got to find him now. It‘s urgent! If I can‘t find him today, I‘ll be dead!Susan: You might want to look it up in the phone book.John: I‘ve checked already, but it seems that hid phone number is unlisted. Susan: Maybe it‘s under his roommate‘s name.John: Well, I guess so.Susan: Well, why don‘t you call Jane? She has his phone number.John: I‘ve tried, but no one answered!Susan: Maybe call his office and ask his secretary.John: I‘ve already tried. She won‘t tell me. She says it‘s private.Susan: Oh, that‘s right. They usually don‘t release private information over the phone.John: It‘s a pity. You usually have a powerful memory, but you can‘t help today.What‘s wrong with you? Your memory seems to be fading early.Susan: It‘s not my memory is fading. I do have memory for face and names, but a poor one for number and datesNow Y our TurnSAMPLE DIALOGA:Hey, do you remember when is the lecture on the value of information by Professor Smith?B: I can‘t think of it off the top of my head. Maybe we can look it up in our notebook, but I don‘t have mine with me.A: That‘s too bas! I don‘t have it with me, either. Do you remember the number of the lecture hail?B: Sorry, I can‘t think of it off my head.A: I‘m terribly interested in the lecture. I can‘t miss it!B: Well, why don‘t you call the dean who arranged the lecture?A: I‘m afraid it‘s not very wise to ask the dean directly.B: Then maybe you can call the office if the department and ask the secretary.A: I‘ve already tried, but no one answered.B: Oh!A: You usually have a powerful memory, but you can‘t help today. You memory seems to be fading early.B: It‘s nit that my memory is fading. I do have a good memory for faces and names, but a poor one for numbers and dates.MODEL3 What‘s wrong with your memory?ScriptBill: Hi, honey! My trip to London was wonderful.Amy: Tell me what thrilled you most.[The telephone rings and Bill answers it....He hangs up.]Bill:Er, where was I?Amy: You were talking about your tour in London.Bill: Oh, yeah.Amy: I bet you had a great time.Bill: Yes, I particularly enjoyed visiting the tower of London.Amy: How did you get there? By bus or underground?Bill: Let me see….Sorry, I can‘t remember any more.Amy: Wha t‘s wrong with your memory?Bill: I hope it‘s not Alzheimer‘s disease. I don‘t want to forget my own name. Amy: I don‘t think so. Perhaps it‘s just temporary forgetfulness. You‘ll be right after a good sleep.Bill: I hope so. But as this is happening so often recently, I think I must go to see a doctor and get some pillsAmy: It‘s not as serous as that. Anyway, I wish you had a good memory for happy events, and a bad one for unhappy things.Now Your TurnSAMPLE DIALOGA: Hey, my trip to Beijing was fantastic.B: Tell me what thrilled you most.[The door bell rings and A answer it….A comes back.]A: Where was I?B: You were talking about your tour in BeijingA: Oh, yeah.B: I bet you had a great time.A: Yes, I particularly enjoyed visiting the Forbidden City and the Great Wall, though the admission fees were a bit too high for me.B: What were the fees?A: Let me see….Sorry, I can‘t remember any more.B: Wha t‘s wrong with your memory?A: I hope it‘s not Alzheimer‘s disease. I don‘t want to see a lot of new people everyday.B: I don‘t think so. Perhaps you only forget things momentarily. You‘ll be right after a good sleep. A: I hope so. But as this is happening so often recently, I think I have to see a doctor.B: I don‘t think it‘s so serious. Anyway, a bad memory helps you forget your trouble.V. Let’s TalkScriptStudent:Professor, thank you for graining me this interview. I‘m Susan, a reporter from the Student Union magazine. Many students have difficultlymemorizing things. Since you‗re an outstanding psychologist, could yougive us some tips on how top improve our memory?Professor: Well, some people have better memories than others, but that‘s largely because they are better at creating mental images.Student: If I‘m not good at creating images, what can I do?Professor: Practice helps. And the mind remembers things better if they are connected with other images. For example, I you have to pick up severalitems at the grocery store, say, carrots, egg, bananas, and milk, you cancreate a picture in your mind of a giant carrot, and hanging from it, abanana.Student: Then I could have a giant milk carton pouring milk over the carrot and banana.Professor: Certainly. Then what would you do with the egg?Student:Hmmm. I‘d visualize an egg-shaped UFO flying across the sky. Professor:There you go. The more you apply the ideas, the easier it gets. Besides creating pictures, there‘s another technique that is very useful. Student:What is it?Professor:Establishing an association. Suppose you are looking for lost keys.Relax, and let your mind look for all the images connected with thosekeys--their feel, the sounds they make.Student:How will that help?Professor:You might remember the sound the keys made when you placed then ina drawer or cold touch of the keys in your jacket were you left them. Student: Oh my gosh! I have to run. It‘s time my English class. I see an image of my teacher staring at my empty seat in the classroom. Many thanks,Professor.Professor: Not at all, and good luck with your memory.SAMPLEA:As we just heard from the interview, the technique of associating certainly important in promoting memory.B:And according to the interview, creating images helps remember things. If your shopping list includes eggs, you might visualize an egg or an egg-shaped UFO flying across.A:Another important factor in improving memory can be of interest. If you get interested in something, you can remember it better.B: Yeah. And if you recognize facts into meaningful groups, you can remember them better. For instance, if you want to memorize all the names of American presidents, it is not easy. If, however, you arrange them chronologically into three periods: those before Abraham Lincoln, those between Abraham Lincoln and Franklin Roosevelt, and those after, then the task will be less difficult.A: It is common sense that if you glance at something quickly, you tend to forget it quickly. If you stuffy it slowly, you can remember it better.B: Another technique is intensive practice or repeating. As a saying goes, practice makes perfect. If you repeat something again and again, you will eventually learn it by heart.A:But we should not work too hard. When we get tired, our learning efficiency declines. We need breaks so the mind can rest and absorb what has been learned.VI. Further Listening and SpeakingTask1: The Role Memory Plays in Our LifeScriptSince memory plays a significant role in our life, scrientists are increasingly interested in research on how to improver memory, Here are some factors they believe to be important to expanding memory capacity.To begin with, you must take special care in your daily life. Food for example, is very important. Some vitamins are essential foe your memory to work properly. They are found in bread, cereal, vegetables and fruits. Some experts say that synthesizes vitamins improve memory, but others have doubts about this, arguing that the studies have not confirmed they do work. Another essential factor is water. It helps to maintain the memory systems, especially in older persons. According to Dr. Roswell, lack of water in the body has an immediate and strong effect on memory; it can cause confusion and other thought difficulties. Sleep also plays a significant role. To be able to have a goof memory, we must allow the brain to have plenty of rest. While sleeping, the brain no longer controls the senses, and starts to revise and store the information one has receives. Lack of sleep would make one feel exhausted and would weaken one‘s ability to concentrate. Also, one‘ ability to store information would be affected.1.What is the passage mainly about?2.Why are foods important in promoting memory according to the passage?3.To whom is water especially important in maintaining the memory system?4.What problem can a lack of water cause?5.Why is sleep important to memory?Keys: 1.A 2.B 3.D 4.D 5.CTask 2: Where did the professor go?ScriptThis is a true story, while happened to friends of ours in a small town in South Africa. They were a hospitable couple who often entertained their neighbors for drinks, tea or dinner. On this particular spring night, they have invited a retired professor to super. During the evening, it began to pour with rain, and the heavens really opened. Because he had walked there, they offered to put him up for the night. They pointed out that by staying overnight, he did not need to go to out in the bad weather. He agreed on the soundness of that idea, thanked his hosts profusely, and the matter seemed to be settled. But while they were washing the dishes after supper, the forgetful professor disappeared. No one could find him anywhere. Eventually, after40minutes, the front door bell rang. There was the professor, soaked to the skin. When he was asked what on earth he has been dong in the rain, he replied that because he was going to stay there overnight, he had gone home to get his pajamas and toothbrush.Task3: How to Remember NamesScriptYou just called the TV repair shop, and the voice on the other end of the line tells you, ―This is Don Smith‖.About 5 minutes later you tell your wife that ―this guy‖will be out to fix the TV in the morning. You can‘t think of his mane although you know he mentioned it on the phone.This happens all the time to just about any of us unless we have learned to concentrate and implant a name in our memory, right at the time we hear it. To do this, you must make a habit of repeating the name back to the person. This action will remind you to store the name in your ―memory bank‖each time you hear someone‘s name, and within a short time the ―repeating‖ process can be discontinuedWhen you meet someone in person, use the same procedure, and in addition, visualize something different, unusual or ridiculous about hid or her appearance, position, or actions that ―ties in ―with his or her name. Later, you may write the descriptive information on one side of a card and the name in the other side. Look at it repeatedly, see the ―picture‖ in your mind‘s eye as you look at the name; or when you see he name, visualize the ―picture‖ you have assigned to the name.Getting this system to work will require changes in your thinking, and it may take several days or several weeks to become proficient.News ReportA Dolphin ExhibitionScriptA recent art exhibition in Florida honored the animal often seen as man‘s most intelligent friend, the dolphin.The ―Dolphins on Parade‖ exhibition in the Florida Keys featured life-sized decorates dolphin paintings made of wood and the cost of materials. The dolphins were shown at area business and along the beach. Sponsors paid U.S. $750 to cover the artists‘ fee and the cost of materials.There were more than 100 dolphin themes, including a beer-belly dolphin. They showed the work of local artists, as well as the beach atmosphere the Keys are famous for.Probably the most unique was special because of its artist, Pandora. Pandora the dolphin painter is area dolphin, art the Dolphin Research center, in Marathon, Florida. The playful artist streaks colors across a dolphin painting holding a brush in its mouth.The exhibition was held by the Monroe [Florida] Council of the Arts as part of a plan to make the Keys an international arts center. The paintings were to be auctioned off in March, with the money earned going to community art programs.Uint2II. Basic Listening Practice3.ScriptW: Have you chosen your elective for next semester yet? Are you taking French writing again?M: Yes I am, but it‘s compulsory for us next semester. So I think I‘m gong to do marketing as an elective instead.Q: Which class will the man choose as his elective?4.ScriptM: Did you go to that businesses lecture on Friday? I missed it and need to copy your notes.W: I‘d say you could borrow my notes, but Sarah‘s got them. Be careful not to miss Professor Brown‘s seminar; he takes attendance in that.Q: What is the woman telling the man?3. ScriptW: Wow, Steven! In the library! What brings you here?M: I‘m enjoying the view. All the girls in fashion design are here are preparing for an exam on Monday.Q: Why is the man in the library?4. ScriptW: How‘s your group doing with this statistics presentation? Mine‘s terrible.M: Yeah, mine too. David and Mike are OK, but Steven doesn‘t pull his weight and Suzie‘s never around. I don‘t see how we can pass unless Steven and Suzie realize that this is their last chance.Q: What is the true of Steven and Suzie?5. ScriptW: You took an MBA at Harvard Business School, didn‘t you? What‘s it like?M: It‘s expensive, about U.S. $ 40,000 a year, plus the costs of food and housing. But the teaching is first class. The professors have a lot of practical experience. Theyuse the case system of teaching; that is, you study how actual businesses grew or failed.Q: Why is he MBA teaching in Harvard Business School first class, according to the conversation?Keys: 1.C 2.D 3.B 4.D 5.AIII. Listening InTask1: On the First DayScriptHarrison: I‘m Harrison. Good to meet you. So you‘ve bought the books for this biology class.Jenny:Sure, I think everyone had to before class started.Harrison: No. Usually no one does much on the first day because it‘s still add-drop. Jenny: What‘s that?Harrison: Changing from class to class to find out which one is best. Hey, where are you from?Jenny: Poland. Have you has this teacher before? I‘ve heard he is really good. Harrison: He‘s good if you‘re a hand-worker. He expects a lot.Jenny: Oh, I guess that‘s good. I hope I can keep up with everyone else in the class. Maybe I need your help after class.Harrison: You‘re welcome.…Professor: All right. See you guys next week.Student: See you.Jenny: Harrison, wait up!Harrison: So what do you think about the professor‘s lecture?Jenny: I think half of what he said went over my head.Harrison: That‘s all right. A lot of what he said is explain in the reading/Jenny: Hey, would you mind if I borrowed your notes tonight to look them over? Harrison: No problem. We don‘t have class until Wednesday. Here you go. Jenny: Thanks. I just want to make sure I‘m prepared for the seminar. Harrison: Yeah, participation in the discussion is an important part of the education here.Seeing that Jenny has bought the books for the biology class, Harrison says nobody does much on the first day because it‘s still add-drop, which means students are changing from class to class. Jenny knows the professor is really good. But Harrison warns her that the professor is good, only if students are hand-workers, for he expects a lot.After class, Jenny admits that half of what the professor said went over her head, and Harrison assures her that a lot of what the professor said is explained in the reading. When Jenny asks to borrow Harrison notes, he says ―on problem‖, for they don‘t have class until Wednesday. Finally, Harrison says participation in the discussio n at the seminar is an important part of the education there.Task 2: Money for CollegeScriptRobert is a university student. He likes to have fun. But having fun was expensive, so he was rapidly running out of money. There was nothing to do to try to call his mother for help.―Hi, Mom. I certainly miss you and Dad. I…uh…got a big surprise this week in my physics course. We have to buy two new textbooks. I‘m going to need $100.‖―I understand,‖ said his mother, ―I‘ll send you the money right away. You left your calculus book here when you were home two weeks ago. Shall I mail that at the same time?‖―Oh, yeah. Thanks,‖ Robert said.Robert‘s mother made up a parcel with the calculus book and two checks, and mailed it to Robert that very day. When she returned from the post office, her husband was waiting for her.―Well, how much did you give the boy this time?‖ asked Dad.―I send two checks: one for $100 and the other for $1, 100,‖ answered Mom.―You‘re outing your mind,‖yelled Dad, ―That‘s $1,100. He‘ll just spend that in a couple of weeks. He‘s never going to learn the value of money that way.‖―Don‘t worry, honey,‖ Mom said, ―I taped the $100 check to the cover of his book, but I put the $1,000 one between the pages in Charper13!‖Keys: TFFFTTask3: How to Get Straight A’sScriptIt is interesting to note how straight A students achieve academic excellence. Here, according to education experts and students themselves are the secrets of super-achievers.First, they know how to set priorities. Top students allow no intrusions on study time. Once the books are open or the computer is turned on, phone calls go unanswered, TV shows unwatched, snacks ignored. Study is business, and business comes before recreation.Also, good students can study anywhere and everywhere. Claudia Hill, an Arizona State University business professor recalls a cross-country runner who worked out every day. Hill persuaded him to use his spare time to memorize biology term. Thenhe posted a list of biology terms on the mirror in the bathroom. He learned a few terms every day while brushing his teeth. Eventually, he scored high on the final examination.Moreover, top students schedule their time well. Study times are strictly a matter of personal preference. Some work late at night when the house is quiet. Others awake early. Still others study as soon as they come home from school when the work is fresh in their minds. All agreed, however, on the need for consistency. A student says, ―Whatever I was doing, I maintained a certain period of time every day for studying.‖Another important characteristic of super-achievers is that they know hoe to read, According to a book entitled Getting Straight A‘s, the secret of good reading is to be ―an active reader-one who continually asks questions that lead to a full understanding of the author‘s message‖.6.Which of the following is NOT mentioned about super—achievers starting tostudy?7.What did the cross-country runner do to score high on the exam?8.What is the good thing all top students agree on?9.What does the speaker mean by ―an active reader‖?10.What is the main idea of the passage?Kes: 1B 2.C3. D 4.A 5.DIV. Speaking OutMODEL 1 Y ou’re just going to have study hardNora: Only our first day back at school, and already I feel like I‘ve learned a lot. Chris: Only our first day back at school, and I already feel like I‘m up to my ears in homework.Nora: You‘re going to have to hit the books if you want to keep your grades up. Chris:Tell me about it! I already have two reports, two books reports, a composition, an oral report, and a research project—all due before midterms.Nora: We could work together. Maybe some of my organized study habit would rub off on you.Chris: Better yet, maybe you could do my homework for me.Nora: Forget it! That would be cheating.Chris: All right, all right. I have yet to write a term paper. Can you recommend any articles and books? You‘d better find me the exact pages where I can find whatI want.Nora: You could borrow ideas from references, but if you quote without giving the sources, you‘re plagiarizing.Chris: The quiz next week will be a headache. If you don‘t help me, I‘ll have to。
[第三版]大学英语听说3听力原文和答案
![[第三版]大学英语听说3听力原文和答案](https://img.taocdn.com/s3/m/0fd6df512f3f5727a5e9856a561252d380eb20af.png)
[第三版]大学英语听说3听力原文和答案Unit 1 ReservationsPart AExercise 11. M: I’d like to book a double room with bath for four nights.W: Sorry, sir. We’re full up(全满). Can I recommend the Park Hotel to you? It is quite near here.Q: What does the woman suggest that the man do?2. M: I’d like to see Mr. Jones this afternoon, please.W: I’m sorry but Mr. Jones will be busy the whole afternoon. Can you manage at 10:30 tomorrow morning?Q: What does the woman say to the man?3. W: Can I book two tickets for the show ―42nd Street‖ on Sunday night, Oct. 31st?M: Sorry, madam. All the tickets on that night are sold out. But tickets are available for Nov.3rd(十一月三号).Q: When can the woman see the show?4. M: I’d like to reserve(预订)two tickets on Flight 6051 to Edinburgh, for October 20th.W: Sorry, Sir. We’re booked up(预订一空的) on the 20th .But we still have a few seats available on the 21st.Q: When does the man want to leave for Edinburgh?5. W: Garden Restaurant. May I help you?M: Can you make arrangements for a table for six at eight this evening? In a quiet corner, please.Q: What does the man want to do?Keys:1. What does the woman suggest that man do? [a. reservethe room in another hotel]2. What does the woman say to the man? [c. Mr. Jones can see the man sometime the next morning.]3. When can the woman see the show? [d. Nov.3rd]4. When does the man want to leave for Edinburgh? [a. on the 20th of October.]5. What does the man want to do? [d. Book a table for six people at 8:00]Exercise 2W: Hello. Dazhong Taxi Company.M: Hello. Can I book a taxi to the West Lake Hotel, Hangzhou?W: Sure. What time?M: 9 o’clock tomorrow morning.W: Your address, please?M: Room 1008, Peace Hotel.W: And your name?M: Jack Smith.W: OK, Mr Smith.M: Thank you.W: Not at all.Keys: Jack Smith Rm 1008.Peach Hotel 9 tomorrow morning West Lake Hotel, HangzhouPart BConversation 1I’d like to make a reservationOperator: Glory Inn, Atlanta.Paul: Hi, this is Paul Lambert. I’m the manager of the band Country Boys. You know, the rock band from Chicago. I want …Operator: Please hold, Mr. Lambert. I’m putting your through to the reservation manager.Paul: But …Manager: Mr. Lambert? This is Laurie Perry, the hotel manager.Paul: Oh, yeah? Well, I need five rooms for Friday night. That’s the 15th. I want the best room in the hotel. Manager: Sorry, I’m afraid I cannot accept your reservation.Paul: Now look, we always stay at the Glory Inn…Manager: I know that, Last time you were here, we had a number of complaints from other guests.Paul: You mean they don’t like long-haired rock musicians Manager: That’s not the problem, sir. The band used bad language in the coffee shop, and threw two TV sets into the pool(把两个电视机扔到池中).Paul: Yeah, yeah. Well, I’11 tell them to be more careful this time.Manager: I’m afraid that’s not all, sir. You haven’t paid the account for the last time yet。
- 1、下载文档前请自行甄别文档内容的完整性，平台不提供额外的编辑、内容补充、找答案等附加服务。
- 2、"仅部分预览"的文档,不可在线预览部分如存在完整性等问题,可反馈申请退款(可完整预览的文档不适用该条件!)。
- 3、如文档侵犯您的权益，请联系客服反馈,我们会尽快为您处理(人工客服工作时间：9:00-18:30)。
Unit 1Part OneListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian.Interviewer: That sounds complicated. Could you explain what you mean?Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to what is polite?Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person?Angela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you suffer and cry for people you don't know, or over a movie that’s only a story, then I think that's a little too sensitive. That's the way I am.I am also a very independent person. I must do things by myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like; and I would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell others any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BListening IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody andself-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different.Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. self-centered5. blond medium height6. runner-upExercise 21. T2. F3. T4. F5. FListening IVDavid: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susan5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter A G IFurther ListeningListening IOne day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) swearing 8) perfectly 9) wildly 10) beeListening IITom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. Taylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything.Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7. D8. C1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. Miller D patient3. Mr. Smith E honest4. Jake A stubborn5. Mrs. Duke F creativeExercise 21. favorite way to relax2. how to divide3. bad unripe4. stiff sore5. fastening a basketball hoopA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scot s’English 2) the friendliest people 3) much nicer than 4) English courtesy 5) no views on the matter/no comments on the matter。